[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplT
DDBJ      :rplT         50S ribosomal protein L20
Swiss-Prot:RL20_FRATM   RecName: Full=50S ribosomal protein L20;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  56/199 : Viruses  0/175   --->[See Alignment]
a.144.2
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->103 1vs6Q PDBj 1e-36 70.6 %
:RPS:PDB   1->104 3bboS PDBj 6e-30 47.1 %
:RPS:SCOP  2->104 1vs6Q1  a.144.2.1 * 4e-32 76.7 %
:HMM:SCOP  61->120 1gyzA_ a.144.2.1 * 1.9e-22 61.7 %
:RPS:PFM   2->100 PF00453 * Ribosomal_L20 2e-23 64.6 %
:HMM:PFM   3->108 PF00453 * Ribosomal_L20 8.9e-50 65.1 106/108  
:BLT:SWISS 1->121 RL20_FRATM 2e-55 100.0 %
:PROS 54->70|PS00937|RIBOSOMAL_L20
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30930.1 GT:GENE rplT GT:PRODUCT 50S ribosomal protein L20 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1097551..1097916) GB:FROM 1097551 GB:TO 1097916 GB:DIRECTION - GB:GENE rplT GB:PRODUCT 50S ribosomal protein L20 GB:PROTEIN_ID ACD30930.1 GB:DB_XREF GI:187712633 GB:GENE:GENE rplT LENGTH 121 SQ:AASEQ MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSLWIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKDAFAAVVEKAKAALAYII GT:EXON 1|1-121:0| SW:ID RL20_FRATM SW:DE RecName: Full=50S ribosomal protein L20; SW:GN Name=rplT; OrderedLocusNames=FTM_1015; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->121|RL20_FRATM|2e-55|100.0|121/121| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 54->70|PS00937|RIBOSOMAL_L20|PDOC00722| SEG 105->118|afaavvekakaala| BL:PDB:NREP 1 BL:PDB:REP 2->103|1vs6Q|1e-36|70.6|102/117| RP:PDB:NREP 1 RP:PDB:REP 1->104|3bboS|6e-30|47.1|104/119| RP:PFM:NREP 1 RP:PFM:REP 2->100|PF00453|2e-23|64.6|99/108|Ribosomal_L20| HM:PFM:NREP 1 HM:PFM:REP 3->108|PF00453|8.9e-50|65.1|106/108|Ribosomal_L20| GO:PFM:NREP 5 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00453|IPR005813| GO:PFM GO:0005622|"GO:intracellular"|PF00453|IPR005813| GO:PFM GO:0005840|"GO:ribosome"|PF00453|IPR005813| GO:PFM GO:0006412|"GO:translation"|PF00453|IPR005813| GO:PFM GO:0019843|"GO:rRNA binding"|PF00453|IPR005813| RP:SCP:NREP 1 RP:SCP:REP 2->104|1vs6Q1|4e-32|76.7|103/117|a.144.2.1| HM:SCP:REP 61->120|1gyzA_|1.9e-22|61.7|60/60|a.144.2.1|1/1|Ribosomal protein L20| OP:NHOMO 990 OP:NHOMOORG 963 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----2------------------------------------------------------------------------------------------------------11111111--1----1-11-1-135---1--111-111--------3-1-11---1--1--111--22-1217111111323-14-111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 86.0 SQ:SECSTR ccccccTTHHHHHHHHHHHHcccccccTTccHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHTcccccccGGGGTTccTT################# DISOP:02AL 120-122| PSIPRED cccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHc //