[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplU
DDBJ      :rplU         ribosomal protein L21
Swiss-Prot:RL21_FRATW   RecName: Full=50S ribosomal protein L21;

Homologs  Archaea  0/68 : Bacteria  342/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.155.1
:104 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->103 1vs6R PDBj 6e-20 47.1 %
:RPS:PDB   1->103 3bboT PDBj 6e-16 21.6 %
:RPS:SCOP  1->103 1vs6R1  b.155.1.1 * 2e-18 47.1 %
:HMM:SCOP  1->104 2i2tR1 b.155.1.1 * 4.5e-33 50.5 %
:RPS:PFM   1->97 PF00829 * Ribosomal_L21p 3e-10 44.2 %
:HMM:PFM   1->97 PF00829 * Ribosomal_L21p 1.3e-37 58.3 96/96  
:BLT:SWISS 1->104 RL21_FRATW 1e-39 100.0 %
:PROS 73->95|PS01169|RIBOSOMAL_L21
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31162.1 GT:GENE rplU GT:PRODUCT ribosomal protein L21 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1407415..1407729) GB:FROM 1407415 GB:TO 1407729 GB:DIRECTION - GB:GENE rplU GB:PRODUCT ribosomal protein L21 GB:PROTEIN_ID ACD31162.1 GB:DB_XREF GI:187712865 GB:GENE:GENE rplU LENGTH 104 SQ:AASEQ MYAIIKNGGKQYKVKEGEVVKLEKFDLGIGEKVEFDTVLMGQTAAGEVKIGAPTVAGAKVVGEVVEQGRHKKVKIMKFRRRKHSMKQQGHRQYFTAVKVSSISL GT:EXON 1|1-104:0| SW:ID RL21_FRATW SW:DE RecName: Full=50S ribosomal protein L21; SW:GN Name=rplU; OrderedLocusNames=FTW_1466; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->104|RL21_FRATW|1e-39|100.0|104/104| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 73->95|PS01169|RIBOSOMAL_L21|PDOC00899| SEG 13->24|kvkegevvklek| SEG 55->66|vagakvvgevve| BL:PDB:NREP 1 BL:PDB:REP 1->103|1vs6R|6e-20|47.1|102/103| RP:PDB:NREP 1 RP:PDB:REP 1->103|3bboT|6e-16|21.6|102/104| RP:PFM:NREP 1 RP:PFM:REP 1->97|PF00829|3e-10|44.2|95/96|Ribosomal_L21p| HM:PFM:NREP 1 HM:PFM:REP 1->97|PF00829|1.3e-37|58.3|96/96|Ribosomal_L21p| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00829|IPR001787| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00829|IPR001787| GO:PFM GO:0005622|"GO:intracellular"|PF00829|IPR001787| GO:PFM GO:0005840|"GO:ribosome"|PF00829|IPR001787| GO:PFM GO:0006412|"GO:translation"|PF00829|IPR001787| RP:SCP:NREP 1 RP:SCP:REP 1->103|1vs6R1|2e-18|47.1|102/103|b.155.1.1| HM:SCP:REP 1->104|2i2tR1|4.5e-33|50.5|103/0|b.155.1.1|1/1|L21p-like| OP:NHOMO 342 OP:NHOMOORG 342 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------1--------------------1-------111---------11111111111111111111----------11--------1-111------------------------------------------------------------------------11--111---111-1111--1-1-1-----1--1-------------11111111111----------1------------1-----1-------------------------1-----------------------------------111111111111111111111-11111111111111111111111111111111111111111-1111111--1-----11-11111111-1111-------1-------------------------11111111111111111111111111111111--1-11111-111--11-11111-111-11-1111111111111111111111111111-11-1111111111--11111111-111111111111---111111-----1111111111111111111-------11-111111----1----1---1111111111111111111111111111111111----11---------------------------1--1-----1--------1-111-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 99.0 SQ:SECSTR cccccccccccccccTTccccccccTccTTcEEEcTTcccccTcccccccccccccccccEEEcccccccccccEEEccTTTTccEEEccccccccccccccc# DISOP:02AL 104-105| PSIPRED cEEEEEEccEEEEEccccEEEEEEEccccccEEEEEEEEEEEcccccEEEccEEEcccEEEEEEEEEccccEEEEEEEcccccccEEccccccEEEEEEEEEEc //