[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplV
DDBJ      :rplV         50S ribosomal protein L22
Swiss-Prot:RL22_FRATW   RecName: Full=50S ribosomal protein L22;

Homologs  Archaea  0/68 : Bacteria  896/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
d.55.1
:111 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->110 1vs6S PDBj 2e-31 59.1 %
:RPS:PDB   1->110 3d5bW PDBj 3e-38 50.0 %
:RPS:SCOP  2->110 1bxeA  d.55.1.1 * 4e-43 48.6 %
:HMM:SCOP  1->110 1bxeA_ d.55.1.1 * 4.1e-40 61.8 %
:RPS:PFM   11->109 PF00237 * Ribosomal_L22 2e-19 54.5 %
:HMM:PFM   5->109 PF00237 * Ribosomal_L22 3.7e-43 54.3 105/105  
:BLT:SWISS 1->111 RL22_FRATW 5e-58 100.0 %
:PROS 83->107|PS00464|RIBOSOMAL_L22

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31344.1 GT:GENE rplV GT:PRODUCT 50S ribosomal protein L22 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1635413..1635748) GB:FROM 1635413 GB:TO 1635748 GB:DIRECTION - GB:GENE rplV GB:PRODUCT 50S ribosomal protein L22 GB:PROTEIN_ID ACD31344.1 GB:DB_XREF GI:187713047 GB:GENE:GENE rplV LENGTH 111 SQ:AASEQ MEVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLNSAVANAEHNDGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAEKK GT:EXON 1|1-111:0| SW:ID RL22_FRATW SW:DE RecName: Full=50S ribosomal protein L22; SW:GN Name=rplV; OrderedLocusNames=FTW_1752; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->111|RL22_FRATW|5e-58|100.0|111/111| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 83->107|PS00464|RIBOSOMAL_L22|PDOC00387| BL:PDB:NREP 1 BL:PDB:REP 1->110|1vs6S|2e-31|59.1|110/110| RP:PDB:NREP 1 RP:PDB:REP 1->110|3d5bW|3e-38|50.0|110/112| RP:PFM:NREP 1 RP:PFM:REP 11->109|PF00237|2e-19|54.5|99/105|Ribosomal_L22| HM:PFM:NREP 1 HM:PFM:REP 5->109|PF00237|3.7e-43|54.3|105/105|Ribosomal_L22| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00237|IPR001063| GO:PFM GO:0005622|"GO:intracellular"|PF00237|IPR001063| GO:PFM GO:0005840|"GO:ribosome"|PF00237|IPR001063| GO:PFM GO:0006412|"GO:translation"|PF00237|IPR001063| RP:SCP:NREP 1 RP:SCP:REP 2->110|1bxeA|4e-43|48.6|109/110|d.55.1.1| HM:SCP:REP 1->110|1bxeA_|4.1e-40|61.8|110/110|d.55.1.1|1/1|Ribosomal protein L22| OP:NHOMO 925 OP:NHOMOORG 912 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-11111111111111111111111111111111111111111111111111111--111111111111111111111---1-1111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1117211211112-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEEccHHHHHHHHHHTTTccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccGGGEEEEEEEEEEEEEEEcccEETTTEEcccEEEEEEEEEEEEEcc PSIPRED ccEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEccccEEEEEEEccccccccEEcccccEEEEEEEcc //