[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplW
DDBJ      :rplW         50S ribosomal protein L23
Swiss-Prot:RL23_FRATW   RecName: Full=50S ribosomal protein L23;

Homologs  Archaea  4/68 : Bacteria  624/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.12.1
:99 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->97 1vs6T PDBj 7e-16 40.2 %
:RPS:PDB   11->92 3bboV PDBj 8e-17 26.1 %
:RPS:SCOP  1->97 1vs6T1  d.12.1.1 * 5e-25 51.5 %
:HMM:SCOP  4->100 1n88A_ d.12.1.1 * 1.8e-26 44.8 %
:RPS:PFM   8->97 PF00276 * Ribosomal_L23 2e-14 48.9 %
:HMM:PFM   11->95 PF00276 * Ribosomal_L23 8.8e-28 42.4 85/92  
:BLT:SWISS 1->99 RL23_FRATW 1e-52 100.0 %
:PROS 81->96|PS00050|RIBOSOMAL_L23

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31347.1 GT:GENE rplW GT:PRODUCT 50S ribosomal protein L23 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1636903..1637202) GB:FROM 1636903 GB:TO 1637202 GB:DIRECTION - GB:GENE rplW GB:PRODUCT 50S ribosomal protein L23 GB:PROTEIN_ID ACD31347.1 GB:DB_XREF GI:187713050 GB:GENE:GENE rplW LENGTH 99 SQ:AASEQ MSSQEKLLKTVIRPHVSDKTYGLSDANSTIVFEVARFANKQDVKNAVEKLFEVKVESVNILNVKGKARRFGRVEGRTKAWKKAYVKLAEGHDINFVGAE GT:EXON 1|1-99:0| SW:ID RL23_FRATW SW:DE RecName: Full=50S ribosomal protein L23; SW:GN Name=rplW; OrderedLocusNames=FTW_1755; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->99|RL23_FRATW|1e-52|100.0|99/99| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 81->96|PS00050|RIBOSOMAL_L23|PDOC00049| BL:PDB:NREP 1 BL:PDB:REP 1->97|1vs6T|7e-16|40.2|97/99| RP:PDB:NREP 1 RP:PDB:REP 11->92|3bboV|8e-17|26.1|69/85| RP:PFM:NREP 1 RP:PFM:REP 8->97|PF00276|2e-14|48.9|90/91|Ribosomal_L23| HM:PFM:NREP 1 HM:PFM:REP 11->95|PF00276|8.8e-28|42.4|85/92|Ribosomal_L23| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00276|IPR013025| GO:PFM GO:0005622|"GO:intracellular"|PF00276|IPR013025| GO:PFM GO:0005840|"GO:ribosome"|PF00276|IPR013025| GO:PFM GO:0006412|"GO:translation"|PF00276|IPR013025| RP:SCP:NREP 1 RP:SCP:REP 1->97|1vs6T1|5e-25|51.5|97/99|d.12.1.1| HM:SCP:REP 4->100|1n88A_|1.8e-26|44.8|96/96|d.12.1.1|1/1|Ribosomal proteins S24e, L23 and L15e| OP:NHOMO 630 OP:NHOMOORG 628 OP:PATTERN ------------------------------------1-----------------1--11--------- 1111-111111111-------111--------1111----111111111111111111----11-1-1--11---1111---111--11111---------111-----1-----------------111111111111111111--1-1-------11111-1--1----11111111111-1----11111111111111111111111111111-11111-11111111111111111111111-1111111-1111-111----111-1-11--------------------------------------11---111-1-1--1111111-1-11--------1-1---11--1--111111111-111-1----211111111111-1111111111111111---1--1-1111-11111111111111111111----1-111111111111111-1------------------------1----1111111111111111111111111111111111111111111111111-111111111111111-1----11-111-11-1-1-111---11111111111111-1-1-------------------------111111111111111111111111111111111-1111111111111111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111111111111----11111111111111-111111111111111111111111111111111111111111111111111111111111111111111111-11-------111-1---1111-111-1111------11--11---1-1--11111--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 100.0 SQ:SECSTR cccTTTGGGccccccccHHHHHHHHTccEEccEEcTTccHHHHHHTTTTTccccEEEcccEEETTTcccccccccccccEEEccEEEcTTTccccccTc PSIPRED cccHHHHHHHHccccccHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEEEcccccccccccccccccEEEEEEEccccccccccccc //