[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rplX
DDBJ      :rplX         50S ribosomal protein L24
Swiss-Prot:RL24_FRATO   RecName: Full=50S ribosomal protein L24;

Homologs  Archaea  0/68 : Bacteria  828/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
b.34.5
:105 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->103 1vs6U PDBj 4e-30 59.0 %
:RPS:PDB   3->104 3bboW PDBj 1e-20 38.6 %
:RPS:SCOP  3->103 1vs6U1  b.34.5.1 * 1e-21 59.0 %
:HMM:SCOP  3->102 2gyaS1 b.34.5.1 * 9.2e-31 48.5 %
:HMM:PFM   6->26 PF00467 * KOW 1.4e-07 57.1 21/32  
:BLT:SWISS 1->105 RL24_FRATO 9e-57 100.0 %
:PROS 7->24|PS01108|RIBOSOMAL_L24

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31338.1 GT:GENE rplX GT:PRODUCT 50S ribosomal protein L24 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1633052..1633369) GB:FROM 1633052 GB:TO 1633369 GB:DIRECTION - GB:GENE rplX GB:PRODUCT 50S ribosomal protein L24 GB:PROTEIN_ID ACD31338.1 GB:DB_XREF GI:187713041 GB:GENE:GENE rplX LENGTH 105 SQ:AASEQ MNRLKKGDDVIVIAGKDKGRRGVVKSFAKGGSLVLVEGINIVKKHIKPNPNRGIEGGVVEKELPVDASNVAIFNPATEKADRVGYKFVDEKKVRYFKSNGELVDL GT:EXON 1|1-105:0| SW:ID RL24_FRATO SW:DE RecName: Full=50S ribosomal protein L24; SW:GN Name=rplX; OrderedLocusNames=FTH_0242; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->105|RL24_FRATO|9e-57|100.0|105/105| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 7->24|PS01108|RIBOSOMAL_L24|PDOC00852| BL:PDB:NREP 1 BL:PDB:REP 3->103|1vs6U|4e-30|59.0|100/102| RP:PDB:NREP 1 RP:PDB:REP 3->104|3bboW|1e-20|38.6|101/110| HM:PFM:NREP 1 HM:PFM:REP 6->26|PF00467|1.4e-07|57.1|21/32|KOW| RP:SCP:NREP 1 RP:SCP:REP 3->103|1vs6U1|1e-21|59.0|100/102|b.34.5.1| HM:SCP:REP 3->102|2gyaS1|9.2e-31|48.5|99/0|b.34.5.1|1/1|Translation proteins SH3-like domain| OP:NHOMO 899 OP:NHOMOORG 858 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-1111111111111111111111111-1-1--1111111--11-111111111111111111111--11111111111---11111111-1---------------111111111-1111111111111111111111111111111111111111111111111111111-11111111111111111111111111111-111111111111111111111111111111111-1-11-11-1111111111111111111111111111111111111111111111111111111111111-1111111111111111111111--11-1111111111111111111-1111111121111111111111111111111111111-11111111111111111111111111111111111111111111111111-111111111111--1111-11111111111111-11111111111111111111111111111111111111111111-1111111111111111111111111111111--1-11111111111111111111----1111111-1111111---------1----111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1211111111111111--11-1-1--1----11111-11111111111111-- -----1--------1----------------------------------------------------------------------------------------112---12-----------------------------------------------1----1---------11-112P122113332-2211--11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 97.1 SQ:SECSTR ##cccccccEEEcccccTTccccccccccccccccccccccccccccccEccccccccccccccccGGGEEEcccccccccccccccccccccccccccccccc# PSIPRED ccccccccEEEEEEccccccEEEEEEEEccccEEEEEcccEEEEEEcccccccccccEEEEEccccHHHEEEEEcccccccEEEEEEEccEEEEEEcccccEEEc //