[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmA
DDBJ      :rpmA         ribosomal protein L27
Swiss-Prot:RL27_FRATW   RecName: Full=50S ribosomal protein L27;

Homologs  Archaea  0/68 : Bacteria  909/915 : Eukaryota  139/199 : Viruses  0/175   --->[See Alignment]
b.84.4
:84 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->83 1vs6W PDBj 2e-32 74.4 %
:RPS:PDB   2->84 3bboX PDBj 1e-25 59.8 %
:RPS:SCOP  2->82 1vs6W1  b.84.4.1 * 9e-29 74.1 %
:HMM:SCOP  20->86 1v8qA_ b.84.4.1 * 2.2e-22 63.6 %
:RPS:PFM   2->82 PF01016 * Ribosomal_L27 2e-20 72.5 %
:HMM:PFM   2->82 PF01016 * Ribosomal_L27 7e-43 73.8 80/81  
:BLT:SWISS 1->84 RL27_FRATW 5e-47 100.0 %
:PROS 34->48|PS00831|RIBOSOMAL_L27

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31161.1 GT:GENE rpmA GT:PRODUCT ribosomal protein L27 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1407130..1407384) GB:FROM 1407130 GB:TO 1407384 GB:DIRECTION - GB:GENE rpmA GB:PRODUCT ribosomal protein L27 GB:PROTEIN_ID ACD31161.1 GB:DB_XREF GI:187712864 GB:GENE:GENE rpmA LENGTH 84 SQ:AASEQ MAHKKAGGSTRNGRDSNPKYLGVKRYGGEFVKAGTIIIRQRGTKTHPGVNVGCGKDHTLFALKDGTVKFHTGGALNRKFVSIEE GT:EXON 1|1-84:0| SW:ID RL27_FRATW SW:DE RecName: Full=50S ribosomal protein L27; SW:GN Name=rpmA; OrderedLocusNames=FTW_1465; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->84|RL27_FRATW|5e-47|100.0|84/84| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 34->48|PS00831|RIBOSOMAL_L27|PDOC00652| BL:PDB:NREP 1 BL:PDB:REP 2->83|1vs6W|2e-32|74.4|82/84| RP:PDB:NREP 1 RP:PDB:REP 2->84|3bboX|1e-25|59.8|82/86| RP:PFM:NREP 1 RP:PFM:REP 2->82|PF01016|2e-20|72.5|80/81|Ribosomal_L27| HM:PFM:NREP 1 HM:PFM:REP 2->82|PF01016|7e-43|73.8|80/81|Ribosomal_L27| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01016|IPR001684| GO:PFM GO:0005622|"GO:intracellular"|PF01016|IPR001684| GO:PFM GO:0005840|"GO:ribosome"|PF01016|IPR001684| GO:PFM GO:0006412|"GO:translation"|PF01016|IPR001684| RP:SCP:NREP 1 RP:SCP:REP 2->82|1vs6W1|9e-29|74.1|81/84|b.84.4.1| HM:SCP:REP 20->86|1v8qA_|2.2e-22|63.6|66/66|b.84.4.1|1/1|Ribosomal L27 protein| OP:NHOMO 1091 OP:NHOMOORG 1048 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11--111-1---1111-111111111-1111111111111111111111---1----1111111111111111111111111111111-12--1111-11--1112-121-1-11-1--11--12111------------1-111-1-2-11-11-------1--1-111---112222D33322343114211211-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 100.0 SQ:SECSTR ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccc PSIPRED cccccccccccccccccccEEEEEEEccEEEccccEEEEccccEEEcccccccccccEEEEccccEEEEEEEcccccEEEEEEc //