[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmB
DDBJ      :rpmB         50S ribosomal protein L28
Swiss-Prot:RL28_FRATW   RecName: Full=50S ribosomal protein L28;

Homologs  Archaea  0/68 : Bacteria  503/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->77 2i2tX PDBj 8e-33 77.6 %
:RPS:PDB   3->77 3bboY PDBj 2e-23 38.7 %
:RPS:SCOP  2->77 2i2tX1  d.325.1.1 * 2e-24 77.6 %
:HMM:SCOP  1->77 2j0111 d.325.1.1 * 5.4e-26 57.3 %
:RPS:PFM   3->63 PF00830 * Ribosomal_L28 6e-15 60.7 %
:HMM:PFM   3->63 PF00830 * Ribosomal_L28 3.2e-32 59.0 61/61  
:BLT:SWISS 1->78 RL28_FRATW 3e-42 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30362.1 GT:GENE rpmB GT:PRODUCT 50S ribosomal protein L28 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 342894..343130 GB:FROM 342894 GB:TO 343130 GB:DIRECTION + GB:GENE rpmB GB:PRODUCT 50S ribosomal protein L28 GB:PROTEIN_ID ACD30362.1 GB:DB_XREF GI:187712065 GB:GENE:GENE rpmB LENGTH 78 SQ:AASEQ MSKVCIVTGKRPATGNNVSHAQNKTKRRFLPNLHAHRFWVESENRYIKLRVSSKGMRIIDKKGIDTVLSDLRAQGHKI GT:EXON 1|1-78:0| SW:ID RL28_FRATW SW:DE RecName: Full=50S ribosomal protein L28; SW:GN Name=rpmB; OrderedLocusNames=FTW_0331; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->78|RL28_FRATW|3e-42|100.0|78/78| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 2->77|2i2tX|8e-33|77.6|76/77| RP:PDB:NREP 1 RP:PDB:REP 3->77|3bboY|2e-23|38.7|75/76| RP:PFM:NREP 1 RP:PFM:REP 3->63|PF00830|6e-15|60.7|61/61|Ribosomal_L28| HM:PFM:NREP 1 HM:PFM:REP 3->63|PF00830|3.2e-32|59.0|61/61|Ribosomal_L28| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00830|IPR001383| GO:PFM GO:0005622|"GO:intracellular"|PF00830|IPR001383| GO:PFM GO:0005840|"GO:ribosome"|PF00830|IPR001383| GO:PFM GO:0006412|"GO:translation"|PF00830|IPR001383| RP:SCP:NREP 1 RP:SCP:REP 2->77|2i2tX1|2e-24|77.6|76/77|d.325.1.1| HM:SCP:REP 1->77|2j0111|5.4e-26|57.3|75/0|d.325.1.1|1/1|L28p-like| OP:NHOMO 518 OP:NHOMOORG 509 OP:PATTERN -------------------------------------------------------------------- -----11111111111-22-21--1122222111111111----1----1111111111111-11-11-1-----1------------1111111111-111111111111111111-11----111111111111111-------------1--11-11--11--------1-1---1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111--111-1---11-1111111-111---1--1--11111111111-1111-1111111111-1111111111111111-11---11111-----------------1-1-11111-11111111111111111111111111111111111111111111111111111111111111111111111------1---1-----------------11--1111-111111-1-------11-1-111111111111111111111111111111111-1111111-111--111111111111-11-1111111111111111111111111111-11111111111111111111-11111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111--111111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1--2-11--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 98.7 SQ:SECSTR ccccccccccTTccccccEEcccccccEEccccccccccccTTccccccccccccTTTTTTcTTTcccccccccccc# DISOP:02AL 78-79| PSIPRED ccccccccccccccccHHHHHHHcccccccccEEEEEEEEcccccEEEEEEEccEEEEHHHccHHHHHHHHHHccccc //