[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmC
DDBJ      :rpmC         50S ribosomal protein L29
Swiss-Prot:RL29_FRATW   RecName: Full=50S ribosomal protein L29;

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.2.2
:66 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->64 1vs6X PDBj 1e-08 38.6 %
:RPS:PDB   2->65 3bboZ PDBj 3e-08 37.5 %
:RPS:SCOP  8->66 1vs6X1  a.2.2.1 * 4e-11 42.4 %
:HMM:SCOP  5->64 2gyaW1 a.2.2.1 * 6.4e-14 40.0 %
:RPS:PFM   7->64 PF00831 * Ribosomal_L29 2e-04 41.4 %
:HMM:PFM   8->64 PF00831 * Ribosomal_L29 2.6e-24 47.4 57/58  
:BLT:SWISS 1->66 RL29_FRATW 4e-33 100.0 %
:PROS 43->57|PS00579|RIBOSOMAL_L29

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31341.1 GT:GENE rpmC GT:PRODUCT 50S ribosomal protein L29 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1634114..1634314) GB:FROM 1634114 GB:TO 1634314 GB:DIRECTION - GB:GENE rpmC GB:PRODUCT 50S ribosomal protein L29 GB:PROTEIN_ID ACD31341.1 GB:DB_XREF GI:187713044 GB:GENE:GENE rpmC LENGTH 66 SQ:AASEQ MKRKDTLKDYRGKSIDQLQEAKIELLQQLFSLRMQKGTGQLKKNHLFKSAKRDIARINTIISEKNK GT:EXON 1|1-66:0| SW:ID RL29_FRATW SW:DE RecName: Full=50S ribosomal protein L29; SW:GN Name=rpmC; OrderedLocusNames=FTW_2082; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|RL29_FRATW|4e-33|100.0|66/66| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 43->57|PS00579|RIBOSOMAL_L29|PDOC00501| BL:PDB:NREP 1 BL:PDB:REP 8->64|1vs6X|1e-08|38.6|57/63| RP:PDB:NREP 1 RP:PDB:REP 2->65|3bboZ|3e-08|37.5|64/65| RP:PFM:NREP 1 RP:PFM:REP 7->64|PF00831|2e-04|41.4|58/58|Ribosomal_L29| HM:PFM:NREP 1 HM:PFM:REP 8->64|PF00831|2.6e-24|47.4|57/58|Ribosomal_L29| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00831|IPR001854| GO:PFM GO:0005622|"GO:intracellular"|PF00831|IPR001854| GO:PFM GO:0005840|"GO:ribosome"|PF00831|IPR001854| GO:PFM GO:0006412|"GO:translation"|PF00831|IPR001854| RP:SCP:NREP 1 RP:SCP:REP 8->66|1vs6X1|4e-11|42.4|59/63|a.2.2.1| HM:SCP:REP 5->64|2gyaW1|6.4e-14|40.0|60/0|a.2.2.1|1/1|Ribosomal protein L29 (L29p)| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1----------------------------------------11------------------------------------------------------------------------------------------------1-------------------------1-11111111-1111-1111111111-1----1------1---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 98.5 SQ:SECSTR #cccccHHHHHHccHHHHHHHHHHHTTHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccH PSIPRED ccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHc //