[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmD
DDBJ      :rpmD         50S ribosomal protein L30
Swiss-Prot:RL30_FRATW   RecName: Full=50S ribosomal protein L30;

Homologs  Archaea  0/68 : Bacteria  298/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.59.1
:61 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->60 1vs6Y PDBj 2e-13 56.1 %
:RPS:PDB   6->60 1bxyA PDBj 7e-14 38.2 %
:RPS:SCOP  6->60 1bxyA  d.59.1.1 * 3e-14 38.2 %
:HMM:SCOP  4->63 1bxyA_ d.59.1.1 * 1.7e-16 55.0 %
:RPS:PFM   8->57 PF00327 * Ribosomal_L30 6e-06 50.0 %
:HMM:PFM   7->57 PF00327 * Ribosomal_L30 2.7e-20 35.3 51/52  
:BLT:SWISS 1->61 RL30_FRATW 6e-31 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31331.1 GT:GENE rpmD GT:PRODUCT 50S ribosomal protein L30 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1630111..1630296) GB:FROM 1630111 GB:TO 1630296 GB:DIRECTION - GB:GENE rpmD GB:PRODUCT 50S ribosomal protein L30 GB:PROTEIN_ID ACD31331.1 GB:DB_XREF GI:187713034 GB:GENE:GENE rpmD LENGTH 61 SQ:AASEQ MTQAKTFKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMANKIYYMVKIEG GT:EXON 1|1-61:0| SW:ID RL30_FRATW SW:DE RecName: Full=50S ribosomal protein L30; SW:GN Name=rpmD; OrderedLocusNames=FTW_1740; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->61|RL30_FRATW|6e-31|100.0|61/61| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 4->60|1vs6Y|2e-13|56.1|57/58| RP:PDB:NREP 1 RP:PDB:REP 6->60|1bxyA|7e-14|38.2|55/60| RP:PFM:NREP 1 RP:PFM:REP 8->57|PF00327|6e-06|50.0|50/52|Ribosomal_L30| HM:PFM:NREP 1 HM:PFM:REP 7->57|PF00327|2.7e-20|35.3|51/52|Ribosomal_L30| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00327|IPR000517| GO:PFM GO:0005622|"GO:intracellular"|PF00327|IPR000517| GO:PFM GO:0005840|"GO:ribosome"|PF00327|IPR000517| GO:PFM GO:0006412|"GO:translation"|PF00327|IPR000517| RP:SCP:NREP 1 RP:SCP:REP 6->60|1bxyA|3e-14|38.2|55/60|d.59.1.1| HM:SCP:REP 4->63|1bxyA_|1.7e-16|55.0|60/60|d.59.1.1|1/1|Ribosomal protein L30p/L7e| OP:NHOMO 298 OP:NHOMOORG 298 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111--111111------------------1------1--------------------------------------------------------------------------------------11----------------------------------------11111111111111111111111111111111111111111111111111111111111-11111111111-1----------------1----1---------------------------------111111111111111111111111111111-1--1-111--1---11111111111111-11-1111111111111111111111111111111111111111111111111111-1111111--111--1111111111-1111-1111-11111111111111111111111111111111111111111111111111111111111111111--1--1-1---111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 57 STR:RPRED 93.4 SQ:SECSTR ###ccEEEEEEccccTTccHHHHHHHHHHTcccTTcEEEEEccHHHHHHHHHTTTTEEEE# DISOP:02AL 61-62| PSIPRED cccccEEEEEEEcccccccHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHEEEcc //