[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmE
DDBJ      :rpmE         50S ribosomal protein L31
Swiss-Prot:RL31_FRATT   RecName: Full=50S ribosomal protein L31;

Homologs  Archaea  0/68 : Bacteria  711/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.325.1
:71 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->65 1vs6Z PDBj 2e-22 62.5 %
:RPS:PDB   2->70 3bbo1 PDBj 5e-22 35.3 %
:RPS:SCOP  1->70 1vs6Z1  d.325.1.2 * 4e-26 58.0 %
:HMM:SCOP  1->71 1vs6Z1 d.325.1.2 * 2.3e-26 52.9 %
:RPS:PFM   1->66 PF01197 * Ribosomal_L31 1e-17 65.2 %
:HMM:PFM   1->66 PF01197 * Ribosomal_L31 2.3e-37 63.6 66/69  
:BLT:SWISS 1->71 RL31_FRATT 7e-40 100.0 %
:PROS 36->57|PS01143|RIBOSOMAL_L31

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30346.1 GT:GENE rpmE GT:PRODUCT 50S ribosomal protein L31 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 318063..318278 GB:FROM 318063 GB:TO 318278 GB:DIRECTION + GB:GENE rpmE GB:PRODUCT 50S ribosomal protein L31 GB:PROTEIN_ID ACD30346.1 GB:DB_XREF GI:187712049 GB:GENE:GENE rpmE LENGTH 71 SQ:AASEQ MRQEIHPKYTEVTVTCSCGNTFVTRSTAGKKEMNIDICSECHPFYTGKQRIVDTAGRVDKFKKRFGGMKKI GT:EXON 1|1-71:0| SW:ID RL31_FRATT SW:DE RecName: Full=50S ribosomal protein L31; SW:GN Name=rpmE; OrderedLocusNames=FTT0366; SW:KW Complete proteome; Metal-binding; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->71|RL31_FRATT|7e-40|100.0|71/71| GO:SWS:NREP 5 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 36->57|PS01143|RIBOSOMAL_L31|PDOC00880| BL:PDB:NREP 1 BL:PDB:REP 1->65|1vs6Z|2e-22|62.5|64/70| RP:PDB:NREP 1 RP:PDB:REP 2->70|3bbo1|5e-22|35.3|68/72| RP:PFM:NREP 1 RP:PFM:REP 1->66|PF01197|1e-17|65.2|66/69|Ribosomal_L31| HM:PFM:NREP 1 HM:PFM:REP 1->66|PF01197|2.3e-37|63.6|66/69|Ribosomal_L31| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01197|IPR002150| GO:PFM GO:0005622|"GO:intracellular"|PF01197|IPR002150| GO:PFM GO:0005840|"GO:ribosome"|PF01197|IPR002150| GO:PFM GO:0006412|"GO:translation"|PF01197|IPR002150| RP:SCP:NREP 1 RP:SCP:REP 1->70|1vs6Z1|4e-26|58.0|69/70|d.325.1.2| HM:SCP:REP 1->71|1vs6Z1|2.3e-26|52.9|70/0|d.325.1.2|1/1|L28p-like| OP:NHOMO 730 OP:NHOMOORG 714 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111112111222111-111121111111111--2112212221112221111111------111111111--11----1-11-1111111--------111111111-1111111111111-111-1-1111-11-1111111-111-11111-1111111111111---------------111111---111----------11--------------------1---11-11-1----1111-----11---1111111-----------11111111111111--------1111111111111111111111111-1111111111111111111111-1-1111111111111-1-11111111111111111111---------111-111111111111111-1--1-------1111111111111111-------------------------------1111-11111111111111111111111111111111111111-111111111111111-1111111111-111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111-111111111-1-1-11-1111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111-1111111111111111-111111111111121111111111111111111111-111111111111111111111111-1-1-1--11111----111111---11111111111-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 100.0 SQ:SECSTR ccTTTcccccHHHHHcccccTTTcccccccccccccccccccccccccccccccccccccccccccccccc PSIPRED cccccccccEEEEEEEccccEEEEEEEccccEEEEEEccccccEEcccEEEEEcccHHHHHHHHHcccccc //