[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmF
DDBJ      :rpmF         50S ribosomal protein L32
Swiss-Prot:RL32_FRATW   RecName: Full=50S ribosomal protein L32;

Homologs  Archaea  0/68 : Bacteria  104/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:60 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->54 1vs60 PDBj 6e-08 58.6 %
:RPS:PDB   22->50 3d5b5 PDBj 2e-05 27.6 %
:RPS:SCOP  2->54 1vs601  g.41.8.5 * 2e-09 45.3 %
:HMM:SCOP  2->56 2i2t01 g.41.8.5 * 1e-19 50.9 %
:RPS:PFM   22->53 PF01783 * Ribosomal_L32p 5e-04 53.1 %
:HMM:PFM   2->55 PF01783 * Ribosomal_L32p 2.4e-23 44.4 54/56  
:BLT:SWISS 1->60 RL32_FRATW 8e-21 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30637.1 GT:GENE rpmF GT:PRODUCT 50S ribosomal protein L32 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(713902..714084) GB:FROM 713902 GB:TO 714084 GB:DIRECTION - GB:GENE rpmF GB:PRODUCT 50S ribosomal protein L32 GB:PROTEIN_ID ACD30637.1 GB:DB_XREF GI:187712340 GB:GENE:GENE rpmF LENGTH 60 SQ:AASEQ MAVQQVKKSRSKRDMRRSHDSLTNPTLSTDKSTGELHLRHHVSPNGFYKGRKVVDTKSED GT:EXON 1|1-60:0| SW:ID RL32_FRATW SW:DE RecName: Full=50S ribosomal protein L32; SW:GN Name=rpmF; OrderedLocusNames=FTW_0520; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->60|RL32_FRATW|8e-21|100.0|60/60| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| SEG 7->21|kksrskrdmrrshds| BL:PDB:NREP 1 BL:PDB:REP 26->54|1vs60|6e-08|58.6|29/56| RP:PDB:NREP 1 RP:PDB:REP 22->50|3d5b5|2e-05|27.6|29/52| RP:PFM:NREP 1 RP:PFM:REP 22->53|PF01783|5e-04|53.1|32/56|Ribosomal_L32p| HM:PFM:NREP 1 HM:PFM:REP 2->55|PF01783|2.4e-23|44.4|54/56|Ribosomal_L32p| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01783|IPR002677| GO:PFM GO:0006412|"GO:translation"|PF01783|IPR002677| GO:PFM GO:0015934|"GO:large ribosomal subunit"|PF01783|IPR002677| RP:SCP:NREP 1 RP:SCP:REP 2->54|1vs601|2e-09|45.3|53/56|g.41.8.5| HM:SCP:REP 2->56|2i2t01|1e-19|50.9|55/0|g.41.8.5|1/1|Zn-binding ribosomal proteins| OP:NHOMO 105 OP:NHOMOORG 104 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111112111111111111111111111111111111-111-1111-11-1111111111111111111----------------------------------------------------------------1------------------------------1--------------------------------------------------------------------------------------------------1111---11-------------------------1111111111111111111111111111-----------------------------1---------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 33 STR:RPRED 55.0 SQ:SECSTR #####################ccccccEEccccccEEccccccTTTcccccccc###### DISOP:02AL 60-61| PSIPRED cccccccccHHHHcccHHHHccccccEEEccccccEEEEEEEccccccccEEEEcccccc //