[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmG
DDBJ      :rpmG         50S ribosomal protein L33
Swiss-Prot:RL33_FRATW   RecName: Full=50S ribosomal protein L33;

Homologs  Archaea  0/68 : Bacteria  393/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:51 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->51 1vs61 PDBj 5e-20 76.5 %
:RPS:PDB   1->49 3bbo3 PDBj 7e-08 30.6 %
:RPS:SCOP  1->51 1vs611  g.41.8.6 * 3e-11 76.5 %
:HMM:SCOP  1->49 2gya11 g.41.8.6 * 1.8e-16 59.2 %
:RPS:PFM   2->49 PF00471 * Ribosomal_L33 3e-04 47.9 %
:HMM:PFM   2->49 PF00471 * Ribosomal_L33 3.3e-24 50.0 48/48  
:BLT:SWISS 1->51 RL33_FRATW 5e-26 100.0 %
:PROS 17->36|PS00582|RIBOSOMAL_L33

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30363.1 GT:GENE rpmG GT:PRODUCT 50S ribosomal protein L33 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 343157..343312 GB:FROM 343157 GB:TO 343312 GB:DIRECTION + GB:GENE rpmG GB:PRODUCT 50S ribosomal protein L33 GB:PROTEIN_ID ACD30363.1 GB:DB_XREF GI:187712066 GB:GENE:GENE rpmG LENGTH 51 SQ:AASEQ MREKIRLVSSAKTGHFYTTTKNKKEMPNKMEIKKYDPVVRKHVMYKEAKIK GT:EXON 1|1-51:0| SW:ID RL33_FRATW SW:DE RecName: Full=50S ribosomal protein L33; SW:GN Name=rpmG; OrderedLocusNames=FTW_0330; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->51|RL33_FRATW|5e-26|100.0|51/51| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 17->36|PS00582|RIBOSOMAL_L33|PDOC00503| BL:PDB:NREP 1 BL:PDB:REP 1->51|1vs61|5e-20|76.5|51/54| RP:PDB:NREP 1 RP:PDB:REP 1->49|3bbo3|7e-08|30.6|49/65| RP:PFM:NREP 1 RP:PFM:REP 2->49|PF00471|3e-04|47.9|48/48|Ribosomal_L33| HM:PFM:NREP 1 HM:PFM:REP 2->49|PF00471|3.3e-24|50.0|48/48|Ribosomal_L33| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00471|IPR001705| GO:PFM GO:0005622|"GO:intracellular"|PF00471|IPR001705| GO:PFM GO:0005840|"GO:ribosome"|PF00471|IPR001705| GO:PFM GO:0006412|"GO:translation"|PF00471|IPR001705| RP:SCP:NREP 1 RP:SCP:REP 1->51|1vs611|3e-11|76.5|51/54|g.41.8.6| HM:SCP:REP 1->49|2gya11|1.8e-16|59.2|49/0|g.41.8.6|1/1|Zn-binding ribosomal proteins| OP:NHOMO 413 OP:NHOMOORG 412 OP:PATTERN -------------------------------------------------------------------- ------1------------------------------1-------------------------1--1---------------------------------------------------------------------11111------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111--111111111111-111111111111-2----1---11111111111111111111111111111111111111111------------------1---1111111111111111111111111111111111111111111111111111111111111111111111111111----------------------------11---------------------------111111111111111111111111111111111-1111111-11111111111111111-11-1111111111111111111111111111111111111111111111111111-1111111111111111---------11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------- -----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-1-111111---11-111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 100.0 SQ:SECSTR cccccEEccccccccccccEEccTTcccccccccccccccccccccccccc DISOP:02AL 50-52| PSIPRED cccEEEEEEEccccEEEEEEccccccccEEEEEEcccccccEEEEEEEEcc //