[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmH
DDBJ      :rpmH         50S ribosomal protein L34
Swiss-Prot:RL34_FRATW   RecName: Full=50S ribosomal protein L34;

Homologs  Archaea  0/68 : Bacteria  411/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:44 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->42 1yl37 PDBj 2e-13 69.0 %
:HMM:PFM   1->44 PF00468 * Ribosomal_L34 2.2e-27 70.5 44/44  
:BLT:SWISS 1->44 RL34_FRATW 6e-21 100.0 %
:PROS 2->21|PS00784|RIBOSOMAL_L34

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31421.1 GT:GENE rpmH GT:PRODUCT 50S ribosomal protein L34 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1725014..1725148 GB:FROM 1725014 GB:TO 1725148 GB:DIRECTION + GB:GENE rpmH GB:PRODUCT 50S ribosomal protein L34 GB:PROTEIN_ID ACD31421.1 GB:DB_XREF GI:187713124 GB:GENE:GENE rpmH LENGTH 44 SQ:AASEQ MKRTFQPSNLKRKRTHGFRARMKTLSGRKVIRNRRAKGRAKLAA GT:EXON 1|1-44:0| SW:ID RL34_FRATW SW:DE RecName: Full=50S ribosomal protein L34; SW:GN Name=rpmH; OrderedLocusNames=FTW_1855; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->44|RL34_FRATW|6e-21|100.0|44/44| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 2->21|PS00784|RIBOSOMAL_L34|PDOC00626| BL:PDB:NREP 1 BL:PDB:REP 1->42|1yl37|2e-13|69.0|42/46| HM:PFM:NREP 1 HM:PFM:REP 1->44|PF00468|2.2e-27|70.5|44/44|Ribosomal_L34| OP:NHOMO 420 OP:NHOMOORG 416 OP:PATTERN -------------------------------------------------------------------- 11--111----1-1-1112-11111111111111111111--111-1----1--------11-11--111-1111-11----------11111------1----11---1----------------1111111111-------------------11--------------------------111-1------11111111111111111------1---111-11-111----------------------1------1-----11----1111---111-111------------------------------------1-----------------11----1---1-11-1-----1--------------1---11111-------------1-111111111-1-111-111-1-----11--111111-1-1111111111111111111-11111111111111-1--1111-111111111111------11111111111-111111111-1111111111-11111-11111--111---1-1--1------------1--1------------1-11--1-111-1-1--1----111111-111-111-1--1111----111-111-------1----1-11-----111-1111111--1---1---------------------------------1--1-----------------1-------11------------111-1111111111----1111111111111111111111111111-1-11-1111--1111111111111-111-111111111111------------------1111111111111-111111--11---1----1----111---1--------- -----------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------4-----111----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 42 STR:RPRED 95.5 SQ:SECSTR ccccccccHHHHHHHccHHHHHHcHHHHHHHHHHHHHHcccc## PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //