[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmI
DDBJ      :rpmI         50S ribosomal protein L35
Swiss-Prot:RL35_FRATW   RecName: Full=50S ribosomal protein L35;

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.301.1
:65 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->65 1vs63 PDBj 4e-06 60.9 %
:RPS:PDB   3->64 3bbo5 PDBj 1e-04 27.4 %
:RPS:SCOP  2->65 1vs631  d.301.1.1 * 1e-07 39.1 %
:HMM:SCOP  2->65 2i2t31 d.301.1.1 * 7e-21 46.9 %
:HMM:PFM   2->59 PF01632 * Ribosomal_L35p 4.6e-23 44.8 58/61  
:BLT:SWISS 1->65 RL35_FRATW 8e-24 100.0 %
:PROS 5->31|PS00936|RIBOSOMAL_L35
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30931.1 GT:GENE rpmI GT:PRODUCT 50S ribosomal protein L35 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1097952..1098149) GB:FROM 1097952 GB:TO 1098149 GB:DIRECTION - GB:GENE rpmI GB:PRODUCT 50S ribosomal protein L35 GB:PROTEIN_ID ACD30931.1 GB:DB_XREF GI:187712634 GB:GENE:GENE rpmI LENGTH 65 SQ:AASEQ MPKLKTKSGAAKRFKKTGKGGFKHRCANRAHINTKMTTKRKRHLRGMNQVAKVDTTSLVQQMPYA GT:EXON 1|1-65:0| SW:ID RL35_FRATW SW:DE RecName: Full=50S ribosomal protein L35; SW:GN Name=rpmI; OrderedLocusNames=FTW_0614; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->65|RL35_FRATW|8e-24|100.0|65/65| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 5->31|PS00936|RIBOSOMAL_L35|PDOC00721| SEG 9->23|gaakrfkktgkggfk| BL:PDB:NREP 1 BL:PDB:REP 2->65|1vs63|4e-06|60.9|64/64| RP:PDB:NREP 1 RP:PDB:REP 3->64|3bbo5|1e-04|27.4|62/62| HM:PFM:NREP 1 HM:PFM:REP 2->59|PF01632|4.6e-23|44.8|58/61|Ribosomal_L35p| RP:SCP:NREP 1 RP:SCP:REP 2->65|1vs631|1e-07|39.1|64/64|d.301.1.1| HM:SCP:REP 2->65|2i2t31|7e-21|46.9|64/0|d.301.1.1|1/1|L35p-like| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 98.5 SQ:SECSTR #ccccccHHHHTTcccccccccEEEccccTTcccccccccTTcccEEEcccTHHHHTTTTTTTcc DISOP:02AL 64-66| PSIPRED ccccHHcHHHHEEEEEcccccEEEcccccccccccccHHHHHHccccEEEcHHHHHHHHHHcccc //