[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpmJ
DDBJ      :rpmJ         50S ribosomal protein L36
Swiss-Prot:RL36_FRATM   RecName: Full=50S ribosomal protein L36;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:37 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->37 2hgu8 PDBj 3e-04 43.2 %
:HMM:SCOP  1->37 2i2t41 g.42.1.1 * 1.9e-13 62.2 %
:HMM:PFM   1->37 PF00444 * Ribosomal_L36 4.1e-22 67.6 37/38  
:BLT:SWISS 1->37 RL36_FRATM 1e-06 100.0 %
:PROS 11->36|PS00828|RIBOSOMAL_L36
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31328.1 GT:GENE rpmJ GT:PRODUCT 50S ribosomal protein L36 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1628200..1628313) GB:FROM 1628200 GB:TO 1628313 GB:DIRECTION - GB:GENE rpmJ GB:PRODUCT 50S ribosomal protein L36 GB:PROTEIN_ID ACD31328.1 GB:DB_XREF GI:187713031 GB:GENE:GENE rpmJ LENGTH 37 SQ:AASEQ MKVRASVKKMCRNCKVIKRNRVVRVICADPRHKQRQG GT:EXON 1|1-37:0| SW:ID RL36_FRATM SW:DE RecName: Full=50S ribosomal protein L36; SW:GN Name=rpmJ; OrderedLocusNames=FTM_1506; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->37|RL36_FRATM|1e-06|100.0|37/37| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 11->36|PS00828|RIBOSOMAL_L36|PDOC00650| SEG 12->27|rnckvikrnrvvrvic| BL:PDB:NREP 1 BL:PDB:REP 1->37|2hgu8|3e-04|43.2|37/37| HM:PFM:NREP 1 HM:PFM:REP 1->37|PF00444|4.1e-22|67.6|37/38|Ribosomal_L36| HM:SCP:REP 1->37|2i2t41|1.9e-13|62.2|37/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 100.0 SQ:SECSTR cccccccccccTTcEEEEETTEEEEEcccGGGcEEcc DISOP:02AL 36-38| PSIPRED ccHHHHHHHHHHccEEEEEccEEEEEEccccHHHHcc //