[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpoA
DDBJ      :rpoA         DNA-directed RNA polymerase, alpha subunit
Swiss-Prot:RPOA1_FRATW  RecName: Full=DNA-directed RNA polymerase subunit alpha 1;         Short=RNAP subunit alpha 1;         EC=2.7.7.6;AltName: Full=Transcriptase subunit alpha 1;AltName: Full=RNA polymerase subunit alpha 1;

Homologs  Archaea  0/68 : Bacteria  910/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
a.60.3d.181.1
:323 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->228 1bdfD PDBj 7e-35 38.9 %
:BLT:PDB   245->316 1lb2B PDBj 3e-24 65.3 %
:RPS:PDB   5->228 1bdfB PDBj 3e-42 37.2 %
:RPS:PDB   245->317 1cooA PDBj 5e-12 64.4 %
:RPS:SCOP  54->176 1bdfA2  d.181.1.1 * 8e-28 36.4 %
:RPS:SCOP  245->316 1lb2B  a.60.3.1 * 1e-10 65.3 %
:HMM:SCOP  54->176 1i6vA2 d.181.1.1 * 4.1e-32 45.1 %
:HMM:SCOP  244->324 1cooA_ a.60.3.1 * 1.5e-23 48.1 %
:RPS:PFM   58->151 PF01000 * RNA_pol_A_bac 3e-12 42.6 %
:RPS:PFM   245->302 PF03118 * RNA_pol_A_CTD 2e-14 62.1 %
:HMM:PFM   245->302 PF03118 * RNA_pol_A_CTD 1.2e-28 53.4 58/67  
:HMM:PFM   65->151 PF01000 * RNA_pol_A_bac 1.7e-17 36.8 87/111  
:BLT:SWISS 1->323 RPOA1_FRATW e-179 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31324.1 GT:GENE rpoA GT:PRODUCT DNA-directed RNA polymerase, alpha subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1625628..1626599) GB:FROM 1625628 GB:TO 1626599 GB:DIRECTION - GB:GENE rpoA GB:PRODUCT DNA-directed RNA polymerase, alpha subunit GB:PROTEIN_ID ACD31324.1 GB:DB_XREF GI:187713027 GB:GENE:GENE rpoA LENGTH 323 SQ:AASEQ MSNNNSKLEFVPNIQLKEDLGAFSYKVQLSPVEKGMAHILGNSIRRVLLSSLSGASIIKVNIANVLHEYSTLEDVKEDVVEIVSNLKKVAIKLDTGIDRLDLELSVNKSGVVSAGDFKTTQGVEIINKDQPIATLTNQRAFSLTATVSVGRNVGILSAIPTELERVGDIAVDADFNPIKRVAFEVFDNGDSETLEVFVKTNGTIEPLAAVTKALEYFCEQISVFVSLRVPSNGKTGDVLIDSNIDPILLKPIDDLELTVRSSNCLRAENIKYLGDLVQYSESQLMKIPNLGKKSLNEIKQILIDNNLSLGVQIDNFRELVEGK GT:EXON 1|1-323:0| SW:ID RPOA1_FRATW SW:DE RecName: Full=DNA-directed RNA polymerase subunit alpha 1; Short=RNAP subunit alpha 1; EC=2.7.7.6;AltName: Full=Transcriptase subunit alpha 1;AltName: Full=RNA polymerase subunit alpha 1; SW:GN Name=rpoA1; OrderedLocusNames=FTW_1733; SW:KW Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->323|RPOA1_FRATW|e-179|100.0|323/323| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 2 BL:PDB:REP 6->228|1bdfD|7e-35|38.9|221/231| BL:PDB:REP 245->316|1lb2B|3e-24|65.3|72/72| RP:PDB:NREP 2 RP:PDB:REP 5->228|1bdfB|3e-42|37.2|223/232| RP:PDB:REP 245->317|1cooA|5e-12|64.4|73/81| RP:PFM:NREP 2 RP:PFM:REP 58->151|PF01000|3e-12|42.6|94/114|RNA_pol_A_bac| RP:PFM:REP 245->302|PF03118|2e-14|62.1|58/67|RNA_pol_A_CTD| HM:PFM:NREP 2 HM:PFM:REP 245->302|PF03118|1.2e-28|53.4|58/67|RNA_pol_A_CTD| HM:PFM:REP 65->151|PF01000|1.7e-17|36.8|87/111|RNA_pol_A_bac| GO:PFM:NREP 6 GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF01000|IPR011262| GO:PFM GO:0006350|"GO:transcription"|PF01000|IPR011262| GO:PFM GO:0046983|"GO:protein dimerization activity"|PF01000|IPR011262| GO:PFM GO:0003677|"GO:DNA binding"|PF03118|IPR011260| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF03118|IPR011260| GO:PFM GO:0006350|"GO:transcription"|PF03118|IPR011260| RP:SCP:NREP 2 RP:SCP:REP 54->176|1bdfA2|8e-28|36.4|121/121|d.181.1.1| RP:SCP:REP 245->316|1lb2B|1e-10|65.3|72/72|a.60.3.1| HM:SCP:REP 54->176|1i6vA2|4.1e-32|45.1|122/0|d.181.1.1|1/1|Insert subdomain of RNA polymerase alpha subunit| HM:SCP:REP 244->324|1cooA_|1.5e-23|48.1|81/0|a.60.3.1|1/1|C-terminal domain of RNA polymerase alpha subunit| OP:NHOMO 935 OP:NHOMOORG 917 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111112111111111111111111111111111111-1111111111111111111111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222222221111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1--------1211---1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 310 STR:RPRED 96.0 SQ:SECSTR ####ccccccccccEEEEEccccEEEEEEEEEcTTHHHHHHHHHHHHHTTccccEEEEEEEETTcccTTcccTTccccHHHHHHHHHTccEEEcccccEEEEEEEEEEEEEEEGGGccccccEEEccTTcEEEEEEEEEEEEEEEEEEEcccEEccGGGcccccTTTcEEccEEcccEEEEEcccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHGGGGTccc###HcccGGGGGccTTHHHHHHcHHHHTccHHHHHHHHHTTcccHHHHHHccHHHHTTcTTccHHHHHHHHHHHHHHccccTccccccc###### PSIPRED ccccccccEEcccEEEEccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccHHHHHHHHccEEEEEcccccEEEEEEEEEccEEEEHHHEEcccccEEEccccEEEEEccccEEEEEEEEEEcccEEEccccccccccccEEEEccccccEEEEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHcccHHHHcccHHHHHHHHHcccccHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccc //