[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpoH
DDBJ      :rpoH         RNA polymerase sigma-32 factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  905/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13c.47.1
:292 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   56->285 3dxjF PDBj 7e-18 27.8 %
:RPS:PDB   22->291 3dxjF PDBj 4e-27 22.1 %
:RPS:SCOP  26->124 1sigA  a.177.1.1 * 7e-27 36.4 %
:RPS:SCOP  112->184 2fug21  c.47.1.21 * 4e-13 17.5 %
:RPS:SCOP  161->202 1rp3A1  a.4.13.1 * 5e-04 23.8 %
:RPS:SCOP  232->286 1ku3A  a.4.13.2 * 1e-08 34.5 %
:HMM:SCOP  16->130 1iw7F3 a.177.1.1 * 6.3e-40 38.3 %
:HMM:SCOP  193->290 1iw7F2 a.4.13.2 * 3.4e-13 26.6 %
:RPS:PFM   60->105 PF04542 * Sigma70_r2 2e-07 47.8 %
:HMM:PFM   60->129 PF04542 * Sigma70_r2 7.5e-22 31.4 70/71  
:HMM:PFM   236->286 PF04545 * Sigma70_r4 6.4e-15 38.8 49/50  
:HMM:PFM   23->49 PF00140 * Sigma70_r1_2 5.1e-06 40.7 27/37  
:HMM:PFM   120->182 PF04963 * Sigma54_CBD 0.00027 31.7 60/195  
:BLT:SWISS 17->288 RP32_HAEIN 1e-82 55.7 %
:PROS 84->97|PS00715|SIGMA70_1
:PROS 258->284|PS00716|SIGMA70_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31135.1 GT:GENE rpoH GT:PRODUCT RNA polymerase sigma-32 factor GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1368983..1369861) GB:FROM 1368983 GB:TO 1369861 GB:DIRECTION - GB:GENE rpoH GB:PRODUCT RNA polymerase sigma-32 factor GB:PROTEIN_ID ACD31135.1 GB:DB_XREF GI:187712838 GB:GENE:GENE rpoH LENGTH 292 SQ:AASEQ MANKKLLPATKTKTLPVVSDNNLSAYLNFVNTLPVLSLEQEQELARRYKYKKDLDAAQQLVLSHLRFVTKIARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGVRLLSFAVHWIKAEMHDYVLKNWKIVKVATTKAQRKLFFNLRSSKDKIGWLSSENIKELAEELGVKEETVIEMEKRMCQGDASLDLPYTDDDGEQTSQQSLYLEDKSSNIEHQVVQQDYYDNFKAIVKDVLSGFDTRTKDIIMSRYLLDNKATLQDLAAKYNISAERVRQIEEDALAKLKKAIKNRS GT:EXON 1|1-292:0| BL:SWS:NREP 1 BL:SWS:REP 17->288|RP32_HAEIN|1e-82|55.7|271/281| PROS 84->97|PS00715|SIGMA70_1|PDOC00592| PROS 258->284|PS00716|SIGMA70_2|PDOC00592| SEG 4->16|kkllpatktktlp| BL:PDB:NREP 1 BL:PDB:REP 56->285|3dxjF|7e-18|27.8|223/349| RP:PDB:NREP 1 RP:PDB:REP 22->291|3dxjF|4e-27|22.1|262/349| RP:PFM:NREP 1 RP:PFM:REP 60->105|PF04542|2e-07|47.8|46/70|Sigma70_r2| HM:PFM:NREP 4 HM:PFM:REP 60->129|PF04542|7.5e-22|31.4|70/71|Sigma70_r2| HM:PFM:REP 236->286|PF04545|6.4e-15|38.8|49/50|Sigma70_r4| HM:PFM:REP 23->49|PF00140|5.1e-06|40.7|27/37|Sigma70_r1_2| HM:PFM:REP 120->182|PF04963|0.00027|31.7|60/195|Sigma54_CBD| GO:PFM:NREP 5 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| RP:SCP:NREP 4 RP:SCP:REP 26->124|1sigA|7e-27|36.4|99/305|a.177.1.1| RP:SCP:REP 112->184|2fug21|4e-13|17.5|63/178|c.47.1.21| RP:SCP:REP 161->202|1rp3A1|5e-04|23.8|42/77|a.4.13.1| RP:SCP:REP 232->286|1ku3A|1e-08|34.5|55/61|a.4.13.2| HM:SCP:REP 16->130|1iw7F3|6.3e-40|38.3|115/184|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 193->290|1iw7F2|3.4e-13|26.6|94/105|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 2452 OP:NHOMOORG 927 OP:PATTERN -------------------------------------------------------------------- 1123422222222233322-2222222222222232434333331111122212111111334253357741111111211372233311111111111111112211141111111111111111-1111111115555611154L68644456666668785545789657555557555522-1111254555555556455556545445655554425112222226411111111111111121111111211211111111111111111111111111111111111111111111111111111111111111155555555556546454554333545323324433553444535574112324222433333224222232223233333333333-33334333333232233333333322233333333333322222222222223432222222222222212222222222222222222222222555565344545544444434546454322333232222224324333222332222222223333222232222222222334433334556557231111111111111111111111111553333433333343333333333333333332-2533322222232333333333333333-33333232333333333333333333323333333333333333323323322333333333333223233333333322333222222222222222222222222233333333353333333332222222222444433333434332222222222222222341111112222222242111111--111111111-111-11112131111111231 -------1----------------------------------------------------------------------------------------------------2------------------------------------------------------------------3111B111126488-53651---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 92.5 SQ:SECSTR #####################cTTTHHHHHHHHHHTccHHHHHHHHHHHccHHHHHHHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHTcccccTTcccEcTTcccccGGGTccccccccHHHHHHHHHHHHHEEEcHHHHHHcccHHHHHHHHHHTTTTTTcHHHHHHHTTcccHHHHHHHHHHHHHHHHHHTTTc# PSIPRED cccccccccHHHcccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHccccccEEcccccccccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcc //