[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpoZ
DDBJ      :rpoZ         DNA-directed RNA polymerase, omega subunit
Swiss-Prot:RPOZ_FRATW   RecName: Full=DNA-directed RNA polymerase subunit omega;         Short=RNAP omega subunit;         EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit;

Homologs  Archaea  0/68 : Bacteria  179/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.143.1
:72 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   6->63 2e2iF PDBj 6e-09 17.5 %
:RPS:SCOP  2->72 1iw7E  a.143.1.1 * 6e-12 15.7 %
:HMM:SCOP  1->70 1i6vE_ a.143.1.1 * 1.1e-15 37.1 %
:RPS:PFM   7->60 PF01192 * RNA_pol_Rpb6 3e-04 43.4 %
:HMM:PFM   7->63 PF01192 * RNA_pol_Rpb6 2.7e-13 30.4 56/57  
:BLT:SWISS 1->72 RPOZ_FRATW 8e-36 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31217.1 GT:GENE rpoZ GT:PRODUCT DNA-directed RNA polymerase, omega subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1485474..1485692) GB:FROM 1485474 GB:TO 1485692 GB:DIRECTION - GB:GENE rpoZ GB:PRODUCT DNA-directed RNA polymerase, omega subunit GB:PROTEIN_ID ACD31217.1 GB:DB_XREF GI:187712920 GB:GENE:GENE rpoZ LENGTH 72 SQ:AASEQ MARVTVEDCLDKVETRFDLVVLASMRANKILKNGYSESMENEKKEKATVVALREIAESEITPEQILRNEIEG GT:EXON 1|1-72:0| SW:ID RPOZ_FRATW SW:DE RecName: Full=DNA-directed RNA polymerase subunit omega; Short=RNAP omega subunit; EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit; SW:GN Name=rpoZ; OrderedLocusNames=FTW_1540; SW:KW Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->72|RPOZ_FRATW|8e-36|100.0|72/72| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| RP:PDB:NREP 1 RP:PDB:REP 6->63|2e2iF|6e-09|17.5|57/86| RP:PFM:NREP 1 RP:PFM:REP 7->60|PF01192|3e-04|43.4|53/57|RNA_pol_Rpb6| HM:PFM:NREP 1 HM:PFM:REP 7->63|PF01192|2.7e-13|30.4|56/57|RNA_pol_Rpb6| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01192|IPR006110| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF01192|IPR006110| GO:PFM GO:0006351|"GO:transcription, DNA-dependent"|PF01192|IPR006110| RP:SCP:NREP 1 RP:SCP:REP 2->72|1iw7E|6e-12|15.7|70/95|a.143.1.1| HM:SCP:REP 1->70|1i6vE_|1.1e-15|37.1|70/0|a.143.1.1|1/1|RPB6/omega subunit-like| OP:NHOMO 179 OP:NHOMOORG 179 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111---1--1--1111111111-1111111---1--111111----------11---1-------------------------------11111---------------------------------------------1--------1---1111111---------------------11--111-1--1------------------------------------1111--1------------------------1------------11------------------------------------------------------1-------1-111111111111---11111111-1111-1---------------11111111111-11111111111111---1111111111111111111-1111111111111-1111111-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 57 STR:RPRED 79.2 SQ:SECSTR #####ccccccccccHHHHHHHHHHHHHHHT#TcccccccccccccTTHHHHHHHHTTccccE######### PSIPRED cccccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccHHHHHHHHHcc //