[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsC
DDBJ      :rpsC         30S ribosomal protein S3
Swiss-Prot:RS3_FRATM    RecName: Full=30S ribosomal protein S3;

Homologs  Archaea  53/68 : Bacteria  910/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
d.52.3d.53.1
:223 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->207 1vs5C PDBj 4e-76 64.6 %
:RPS:PDB   1->206 3bbnC PDBj 2e-63 37.9 %
:RPS:SCOP  2->106 1fjgC1  d.52.3.1 * 1e-37 44.8 %
:RPS:SCOP  107->207 1fjgC2  d.53.1.1 * 2e-35 49.5 %
:HMM:SCOP  2->106 1fjgC1 d.52.3.1 * 1.2e-39 59.0 %
:HMM:SCOP  107->207 1fjgC2 d.53.1.1 * 2.8e-40 66.3 %
:RPS:PFM   1->60 PF00417 * Ribosomal_S3_N 1e-14 51.7 %
:RPS:PFM   65->116 PF07650 * KH_2 7e-09 60.9 %
:RPS:PFM   119->202 PF00189 * Ribosomal_S3_C 2e-22 67.9 %
:HMM:PFM   120->202 PF00189 * Ribosomal_S3_C 1.6e-36 62.7 83/85  
:HMM:PFM   1->61 PF00417 * Ribosomal_S3_N 2.8e-24 44.3 61/66  
:HMM:PFM   65->117 PF07650 * KH_2 2.3e-17 51.1 47/59  
:BLT:SWISS 1->223 RS3_FRATM e-115 100.0 %
:PROS 163->197|PS00548|RIBOSOMAL_S3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31343.1 GT:GENE rpsC GT:PRODUCT 30S ribosomal protein S3 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1634727..1635398) GB:FROM 1634727 GB:TO 1635398 GB:DIRECTION - GB:GENE rpsC GB:PRODUCT 30S ribosomal protein S3 GB:PROTEIN_ID ACD31343.1 GB:DB_XREF GI:187713046 GB:GENE:GENE rpsC LENGTH 223 SQ:AASEQ MGQKVNPNGIRLGYIRDWRSTWYADSSRYATKLNEDIKVREFLHKKLAAAAVSKIQIERPAQNAKITIHTARPGIVIGKKGDDVEKLRAEVHKLMGIPVQINIEEVRKPEIDAKLVAESVAQQLEKRVMFRRAMKKAMQAAMKSGAKGIKIMVSGRLGGAEIARSEWARDGRVPLQTFRADVDYATAEALTTYGVIGVKVWIYKGEILPGQIAEKKNNKKGAK GT:EXON 1|1-223:0| SW:ID RS3_FRATM SW:DE RecName: Full=30S ribosomal protein S3; SW:GN Name=rpsC; OrderedLocusNames=FTM_1521; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->223|RS3_FRATM|e-115|100.0|223/223| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 163->197|PS00548|RIBOSOMAL_S3|PDOC00474| SEG 133->147|amkkamqaamksgak| BL:PDB:NREP 1 BL:PDB:REP 2->207|1vs5C|4e-76|64.6|206/206| RP:PDB:NREP 1 RP:PDB:REP 1->206|3bbnC|2e-63|37.9|206/217| RP:PFM:NREP 3 RP:PFM:REP 1->60|PF00417|1e-14|51.7|60/68|Ribosomal_S3_N| RP:PFM:REP 65->116|PF07650|7e-09|60.9|46/49|KH_2| RP:PFM:REP 119->202|PF00189|2e-22|67.9|84/84|Ribosomal_S3_C| HM:PFM:NREP 3 HM:PFM:REP 120->202|PF00189|1.6e-36|62.7|83/85|Ribosomal_S3_C| HM:PFM:REP 1->61|PF00417|2.8e-24|44.3|61/66|Ribosomal_S3_N| HM:PFM:REP 65->117|PF07650|2.3e-17|51.1|47/59|KH_2| GO:PFM:NREP 9 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00417|IPR008282| GO:PFM GO:0005622|"GO:intracellular"|PF00417|IPR008282| GO:PFM GO:0005840|"GO:ribosome"|PF00417|IPR008282| GO:PFM GO:0006412|"GO:translation"|PF00417|IPR008282| GO:PFM GO:0003723|"GO:RNA binding"|PF07650|IPR004044| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00189|IPR001351| GO:PFM GO:0005622|"GO:intracellular"|PF00189|IPR001351| GO:PFM GO:0005840|"GO:ribosome"|PF00189|IPR001351| GO:PFM GO:0006412|"GO:translation"|PF00189|IPR001351| RP:SCP:NREP 2 RP:SCP:REP 2->106|1fjgC1|1e-37|44.8|105/105|d.52.3.1| RP:SCP:REP 107->207|1fjgC2|2e-35|49.5|101/101|d.53.1.1| HM:SCP:REP 2->106|1fjgC1|1.2e-39|59.0|105/0|d.52.3.1|1/1|Prokaryotic type KH domain (KH-domain type II)| HM:SCP:REP 107->207|1fjgC2|2.8e-40|66.3|101/101|d.53.1.1|1/1|Ribosomal protein S3 C-terminal domain| OP:NHOMO 985 OP:NHOMOORG 976 OP:PATTERN 1111-111111111111------1-1111-111-1111111111-11-11111-11111111111--1 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------111--------------------------------------------------------------------------------1----1-----------------------------1-------------------1-----------------------11----------125--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 92.8 SQ:SECSTR ccccccTTTccTTTTccccccccccTTccHHHHHHHHHHHcccccTTTTTcEEEEEccccccccccEEEEccTTTTccccccTTHHHHHHHHHHccccccccEEEcccTTTcHHHHHHHcTTTTTTTccHHHHHTHHHHHHHTTcccEEEEEcccccTTcccccccEEEEEcccccccTTcccccEEEccccccccEEEEEEEcccc################ PSIPRED ccccccccEEEEEEEEccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccccccccccHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccEEEEEEccccccHHEEEEEEEEcccccccccccccEEEEEEEEEcccEEEEEEEEccccccccccccccccccccc //