[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsF
DDBJ      :rpsF         30S ribosomal protein S6
Swiss-Prot:RS6_FRATW    RecName: Full=30S ribosomal protein S6;

Homologs  Archaea  0/68 : Bacteria  543/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.58.14
:111 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->100 1vs5F PDBj 1e-34 58.0 %
:RPS:PDB   1->96 2bxjA PDBj 3e-27 27.1 %
:RPS:SCOP  1->100 1vs5F1  d.58.14.1 * 3e-27 58.0 %
:HMM:SCOP  1->104 1vmbA_ d.58.14.1 * 3.2e-31 44.2 %
:RPS:PFM   3->90 PF01250 * Ribosomal_S6 5e-21 46.6 %
:HMM:PFM   2->91 PF01250 * Ribosomal_S6 4.3e-33 41.1 90/92  
:BLT:SWISS 1->111 RS6_FRATW 1e-61 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30829.1 GT:GENE rpsF GT:PRODUCT 30S ribosomal protein S6 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 973066..973401 GB:FROM 973066 GB:TO 973401 GB:DIRECTION + GB:GENE rpsF GB:PRODUCT 30S ribosomal protein S6 GB:PROTEIN_ID ACD30829.1 GB:DB_XREF GI:187712532 GB:GENE:GENE rpsF LENGTH 111 SQ:AASEQ MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI GT:EXON 1|1-111:0| SW:ID RS6_FRATW SW:DE RecName: Full=30S ribosomal protein S6; SW:GN Name=rpsF; OrderedLocusNames=FTW_0972; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->111|RS6_FRATW|1e-61|100.0|111/111| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 1->100|1vs5F|1e-34|58.0|100/100| RP:PDB:NREP 1 RP:PDB:REP 1->96|2bxjA|3e-27|27.1|96/98| RP:PFM:NREP 1 RP:PFM:REP 3->90|PF01250|5e-21|46.6|88/92|Ribosomal_S6| HM:PFM:NREP 1 HM:PFM:REP 2->91|PF01250|4.3e-33|41.1|90/92|Ribosomal_S6| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01250|IPR000529| GO:PFM GO:0005840|"GO:ribosome"|PF01250|IPR000529| GO:PFM GO:0006412|"GO:translation"|PF01250|IPR000529| GO:PFM GO:0019843|"GO:rRNA binding"|PF01250|IPR000529| RP:SCP:NREP 1 RP:SCP:REP 1->100|1vs5F1|3e-27|58.0|100/100|d.58.14.1| HM:SCP:REP 1->104|1vmbA_|3.2e-31|44.2|104/0|d.58.14.1|1/1|Ribosomal protein S6| OP:NHOMO 549 OP:NHOMOORG 547 OP:PATTERN -------------------------------------------------------------------- --1--11----11----11-1-----11111-----1-111-1-----111-11111---11-1---111--------1---11-1111111--11--------1-1-----------------------------1-1------1-11---1------------1-11----------------------11-111111111111111-111--111111-1-1------11---------------1----------------------------------------------------------------------------1111111111111-1111111--111---11--111-1111111-1-----111111111111111111111111111111111-11111111111112-11111111111111111111111111111111-1111111------------1-11111111111-----11-1111111111111111111111111111111111111111111111111111111111111111111111111111--11-111111-1--1-1-11------1-----1-----------------11-111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 90.1 SQ:SECSTR cEEEEEEEEEcTTccHHHHHHHHHHHHHHHTTTcEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEcHHHHHHHHHHHHTcTTEEEEEEEEccccccccc########### PSIPRED ccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEHHcccccccEEcccccEEEEEEEEEEccHHHHHHHHHHHcccHHHHHEEEEEEccccccHHHHHHHHHHccc //