[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsH
DDBJ      :rpsH         30S ribosomal protein S8
Swiss-Prot:RS8_FRATW    RecName: Full=30S ribosomal protein S8;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
d.140.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->132 1vs5H PDBj 1e-36 59.4 %
:RPS:PDB   3->131 3bbnH PDBj 2e-40 37.5 %
:RPS:SCOP  2->131 1i6uA  d.140.1.1 * 2e-38 25.4 %
:HMM:SCOP  4->131 1an7A_ d.140.1.1 * 6.5e-40 48.0 %
:RPS:PFM   5->132 PF00410 * Ribosomal_S8 1e-30 52.0 %
:HMM:PFM   5->131 PF00410 * Ribosomal_S8 3.3e-47 51.2 127/129  
:BLT:SWISS 1->132 RS8_FRATW 2e-72 100.0 %
:PROS 102->119|PS00053|RIBOSOMAL_S8

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31335.1 GT:GENE rpsH GT:PRODUCT 30S ribosomal protein S8 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1631762..1632160) GB:FROM 1631762 GB:TO 1632160 GB:DIRECTION - GB:GENE rpsH GB:PRODUCT 30S ribosomal protein S8 GB:PROTEIN_ID ACD31335.1 GB:DB_XREF GI:187713038 GB:GENE:GENE rpsH LENGTH 132 SQ:AASEQ MSMQDPIADMFTRIRNGLSAEKEFVSVPFSKIKMEIANFLVNEGYIKSCSKGTTSMGHPSIEVELKYHAGAPVIEMIKRVSRPSLRIYKSHADLPKVYGGYGVAIVSTSKGLVSDRKARDLGVGGEIIGYVA GT:EXON 1|1-132:0| SW:ID RS8_FRATW SW:DE RecName: Full=30S ribosomal protein S8; SW:GN Name=rpsH; OrderedLocusNames=FTW_1744; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->132|RS8_FRATW|2e-72|100.0|132/132| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 102->119|PS00053|RIBOSOMAL_S8|PDOC00052| BL:PDB:NREP 1 BL:PDB:REP 2->132|1vs5H|1e-36|59.4|128/129| RP:PDB:NREP 1 RP:PDB:REP 3->131|3bbnH|2e-40|37.5|128/134| RP:PFM:NREP 1 RP:PFM:REP 5->132|PF00410|1e-30|52.0|127/127|Ribosomal_S8| HM:PFM:NREP 1 HM:PFM:REP 5->131|PF00410|3.3e-47|51.2|127/129|Ribosomal_S8| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00410|IPR000630| GO:PFM GO:0005622|"GO:intracellular"|PF00410|IPR000630| GO:PFM GO:0005840|"GO:ribosome"|PF00410|IPR000630| GO:PFM GO:0006412|"GO:translation"|PF00410|IPR000630| RP:SCP:NREP 1 RP:SCP:REP 2->131|1i6uA|2e-38|25.4|126/129|d.140.1.1| HM:SCP:REP 4->131|1an7A_|6.5e-40|48.0|127/136|d.140.1.1|1/1|Ribosomal protein S8| OP:NHOMO 919 OP:NHOMOORG 917 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -------------------------------------------------------------------------------------------------------111---------------------------------------------------------------------1-1------1-111--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 99.2 SQ:SECSTR #ccccHHHHHHHHHHHHHHTTccEEEEEccHHHHHHTHHHHTTTccccEEEEEcccccEEEEEEccccccccccccEEEcccTTcccEEcccccccGGGTTcEEEEEEcccEEcTTHHHHHTccEEEEEEEc DISOP:02AL 132-133| PSIPRED ccccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccccEEEEEccccEEEEEEEEEEccccccccccEEcccccEEEEccHHHHHHHHccccEEEEEcccccccHHHHHHcccccEEEEEEc //