[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsI
DDBJ      :rpsI         30S ribosomal protein S9
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  894/915 : Eukaryota  98/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->117 1vs5I PDBj 2e-32 58.9 %
:RPS:PDB   6->117 3bbnI PDBj 1e-35 41.1 %
:RPS:SCOP  3->117 1fjgI  d.14.1.1 * 5e-36 39.1 %
:HMM:SCOP  3->129 1fjgI_ d.14.1.1 * 2.3e-47 52.8 %
:RPS:PFM   9->117 PF00380 * Ribosomal_S9 5e-25 52.3 %
:HMM:PFM   9->129 PF00380 * Ribosomal_S9 9.4e-50 52.9 121/121  
:BLT:SWISS 1->117 RS9_HERAR 9e-38 60.7 %
:PROS 68->86|PS00360|RIBOSOMAL_S9
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30971.1 GT:GENE rpsI GT:PRODUCT 30S ribosomal protein S9 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1144847..1145236 GB:FROM 1144847 GB:TO 1145236 GB:DIRECTION + GB:GENE rpsI GB:PRODUCT 30S ribosomal protein S9 GB:PROTEIN_ID ACD30971.1 GB:DB_XREF GI:187712674 GB:GENE:GENE rpsI LENGTH 129 SQ:AASEQ MSEYNYGTGRRKSSVARVFMKKGTGQFIVNGLPLEQYLCRETDCMVVKQPLELTNNTDNFDFKVTVKGGGTTGQAGAIRLGVTRALIEYDEELKPALREAGFVTRDPRKVERKKFGLRKARRRRQFSKR GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 1->117|RS9_HERAR|9e-38|60.7|117/130| PROS 68->86|PS00360|RIBOSOMAL_S9|PDOC00311| SEG 63->73|kvtvkgggttg| SEG 118->128|rkarrrrqfsk| BL:PDB:NREP 1 BL:PDB:REP 6->117|1vs5I|2e-32|58.9|112/127| RP:PDB:NREP 1 RP:PDB:REP 6->117|3bbnI|1e-35|41.1|112/127| RP:PFM:NREP 1 RP:PFM:REP 9->117|PF00380|5e-25|52.3|109/121|Ribosomal_S9| HM:PFM:NREP 1 HM:PFM:REP 9->129|PF00380|9.4e-50|52.9|121/121|Ribosomal_S9| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00380|IPR000754| GO:PFM GO:0005622|"GO:intracellular"|PF00380|IPR000754| GO:PFM GO:0005840|"GO:ribosome"|PF00380|IPR000754| GO:PFM GO:0006412|"GO:translation"|PF00380|IPR000754| RP:SCP:NREP 1 RP:SCP:REP 3->117|1fjgI|5e-36|39.1|115/127|d.14.1.1| HM:SCP:REP 3->129|1fjgI_|2.3e-47|52.8|127/127|d.14.1.1|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 1011 OP:NHOMOORG 993 OP:PATTERN ----------------------------------------------------------------1--- 1111111111111111111-111111111111111111111111-111--------111111--111--1-11111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111121111111111121111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----1-1-------1111--1111-1-1111-11-11211111-1-1111111111111111111111--111-1111111111-111---11----------111-1-11----1------------------------------------------11--11---------11---16111-12243122-111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 90.7 SQ:SECSTR TTccHccccEETTEEEEEEEEEccccEEETTEEHHHHccccGGGTTTcHHHHTTTcTTTEEEEEEEEcccHHHHHHHHHHHHHHHTTTccGGGcHHHHTTTcccccccccccccTTc############ DISOP:02AL 129-130| PSIPRED cccEEEEEEEEEEEEEEEEEEccccEEEEccEEHHHHcccHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccccccccccccccccccccccc //