[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsK
DDBJ      :rpsK         30S ribosomal protein S11
Swiss-Prot:RS11_FRATM   RecName: Full=30S ribosomal protein S11;

Homologs  Archaea  29/68 : Bacteria  906/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
c.55.4
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->129 1vs5K PDBj 7e-43 66.4 %
:RPS:PDB   20->126 2e5lK PDBj 6e-35 51.4 %
:RPS:SCOP  20->128 1fjgK  c.55.4.1 * 4e-37 51.4 %
:HMM:SCOP  13->129 1fjgK_ c.55.4.1 * 4.4e-42 60.7 %
:RPS:PFM   20->128 PF00411 * Ribosomal_S11 9e-32 58.7 %
:HMM:PFM   20->128 PF00411 * Ribosomal_S11 1.6e-48 55.0 109/110  
:BLT:SWISS 17->129 RS11_FRATM 1e-53 100.0 %
:PROS 97->119|PS00054|RIBOSOMAL_S11
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31326.1 GT:GENE rpsK GT:PRODUCT 30S ribosomal protein S11 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1627299..1627688) GB:FROM 1627299 GB:TO 1627688 GB:DIRECTION - GB:GENE rpsK GB:PRODUCT 30S ribosomal protein S11 GB:PROTEIN_ID ACD31326.1 GB:DB_XREF GI:187713029 GB:GENE:GENE rpsK LENGTH 129 SQ:AASEQ MAKSVRSSKKKVKRVVTDAVAHIYSSFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTPFAAQVAAERAADMALEYGVRNVDVLVKGPGSGRDSAVRALNVKNLKVTSITDVTPLPHNGCRPPKKRRV GT:EXON 1|1-129:0| SW:ID RS11_FRATM SW:DE RecName: Full=30S ribosomal protein S11; SW:GN Name=rpsK; OrderedLocusNames=FTM_1504; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 17->129|RS11_FRATM|1e-53|100.0|113/129| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 97->119|PS00054|RIBOSOMAL_S11|PDOC00053| SEG 3->16|ksvrsskkkvkrvv| SEG 47->58|sggsgfrgsrks| BL:PDB:NREP 1 BL:PDB:REP 17->129|1vs5K|7e-43|66.4|113/117| RP:PDB:NREP 1 RP:PDB:REP 20->126|2e5lK|6e-35|51.4|107/115| RP:PFM:NREP 1 RP:PFM:REP 20->128|PF00411|9e-32|58.7|109/109|Ribosomal_S11| HM:PFM:NREP 1 HM:PFM:REP 20->128|PF00411|1.6e-48|55.0|109/110|Ribosomal_S11| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00411|IPR001971| GO:PFM GO:0005622|"GO:intracellular"|PF00411|IPR001971| GO:PFM GO:0005840|"GO:ribosome"|PF00411|IPR001971| GO:PFM GO:0006412|"GO:translation"|PF00411|IPR001971| RP:SCP:NREP 1 RP:SCP:REP 20->128|1fjgK|4e-37|51.4|109/119|c.55.4.1| HM:SCP:REP 13->129|1fjgK_|4.4e-42|60.7|117/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 1096 OP:NHOMOORG 1019 OP:PATTERN --------11111111--------1-111111-1----11111--1-1-1111---------11---- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111--1--111111111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ---1--11----111----------------------------------------------------------------------------------------111--1113322311-1121152-4-685-324121122121-1111211213222---31-1-111-21133131811112-1-5--3111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 87.6 SQ:SECSTR ################cccEEEEEccccccEEEEEcTTccEEEEEccTTTTcccGGGGcHHHHHHHHHHHHHTTGGGTccEEEEEEEcccccHHHHHHHHHHHTcEEEEEEEccccccccccccccccc DISOP:02AL 129-130| PSIPRED ccccccccccEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEccccEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHcccEEEEEEEccccccccccccccccc //