[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsL
DDBJ      :rpsL         30S ribosomal protein S12
Swiss-Prot:RS12_FRATW   RecName: Full=30S ribosomal protein S12;

Homologs  Archaea  4/68 : Bacteria  904/915 : Eukaryota  159/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:124 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->124 1vs5L PDBj 7e-58 82.9 %
:RPS:PDB   1->123 3bbnL PDBj 3e-50 74.0 %
:RPS:SCOP  3->124 1fjgL  b.40.4.5 * 8e-49 76.2 %
:HMM:SCOP  2->126 1fjgL_ b.40.4.5 * 2.1e-51 63.2 %
:RPS:PFM   2->123 PF00164 * Ribosomal_S12 3e-43 79.5 %
:HMM:PFM   3->123 PF00164 * Ribosomal_S12 5.4e-58 61.2 121/122  
:BLT:SWISS 1->124 RS12_FRATW 2e-69 100.0 %
:PROS 43->50|PS00055|RIBOSOMAL_S12

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31353.1 GT:GENE rpsL GT:PRODUCT 30S ribosomal protein S12 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1641570..1641944) GB:FROM 1641570 GB:TO 1641944 GB:DIRECTION - GB:GENE rpsL GB:PRODUCT 30S ribosomal protein S12 GB:PROTEIN_ID ACD31353.1 GB:DB_XREF GI:187713056 GB:GENE:GENE rpsL LENGTH 124 SQ:AASEQ MATINQLVNNPRKRSVVKSKVPALKACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSRFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTSGVNNRKHGRSKYGTKRPKS GT:EXON 1|1-124:0| SW:ID RS12_FRATW SW:DE RecName: Full=30S ribosomal protein S12; SW:GN Name=rpsL; OrderedLocusNames=FTW_1761; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->124|RS12_FRATW|2e-69|100.0|124/124| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 43->50|PS00055|RIBOSOMAL_S12|PDOC00054| BL:PDB:NREP 1 BL:PDB:REP 2->124|1vs5L|7e-58|82.9|123/123| RP:PDB:NREP 1 RP:PDB:REP 1->123|3bbnL|3e-50|74.0|123/123| RP:PFM:NREP 1 RP:PFM:REP 2->123|PF00164|3e-43|79.5|122/122|Ribosomal_S12| HM:PFM:NREP 1 HM:PFM:REP 3->123|PF00164|5.4e-58|61.2|121/122|Ribosomal_S12| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00164|IPR006032| GO:PFM GO:0005622|"GO:intracellular"|PF00164|IPR006032| GO:PFM GO:0005840|"GO:ribosome"|PF00164|IPR006032| GO:PFM GO:0006412|"GO:translation"|PF00164|IPR006032| RP:SCP:NREP 1 RP:SCP:REP 3->124|1fjgL|8e-49|76.2|122/125|b.40.4.5| HM:SCP:REP 2->126|1fjgL_|2.1e-51|63.2|125/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1095 OP:NHOMOORG 1067 OP:PATTERN ---------------------------------------------------------1111------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111112-11111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111211111111111111111111111111111111111111111111111111111111111111111111111--111111111111111-11-111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------1---1111111111111111111--11111-111111111111111111111-111111111111111111111111121-11111111111111111-1--21211--1111-1111121323-111111111111-11-1111111111211111111-111121211--------3-8112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 100.0 SQ:SECSTR cccTTHHHHTcccccccccccccTTTcccEEEEEEEEEEEcccccccccEEEEEEEETTccEEEEEcccccccccTTcEEEEccccccccTTccEEccTTcTTccccTTcccccccTTcccccc PSIPRED cccHHHHHHccccccccccccccccccccccEEEEEEEEEcccccccccccEEEEEEccccEEEEEccccccccccccEEEEcccccccccccEEEEEccEEEccccccccccccccccccccc //