[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsM
DDBJ      :rpsM         30S ribosomal protein S13
Swiss-Prot:RS13_FRATW   RecName: Full=30S ribosomal protein S13;

Homologs  Archaea  5/68 : Bacteria  907/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
a.156.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->116 2gy9M PDBj 5e-47 73.9 %
:RPS:PDB   2->116 3d5aM PDBj 3e-29 58.3 %
:RPS:SCOP  2->117 1fjgM  a.156.1.1 * 3e-28 57.8 %
:HMM:SCOP  2->120 1fjgM_ a.156.1.1 * 1.2e-41 52.9 %
:RPS:PFM   3->108 PF00416 * Ribosomal_S13 2e-25 60.4 %
:HMM:PFM   3->108 PF00416 * Ribosomal_S13 4.6e-40 45.3 106/106  
:BLT:SWISS 1->118 RS13_FRATW 3e-65 100.0 %
:PROS 87->100|PS00646|RIBOSOMAL_S13_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31327.1 GT:GENE rpsM GT:PRODUCT 30S ribosomal protein S13 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1627727..1628083) GB:FROM 1627727 GB:TO 1628083 GB:DIRECTION - GB:GENE rpsM GB:PRODUCT 30S ribosomal protein S13 GB:PROTEIN_ID ACD31327.1 GB:DB_XREF GI:187713030 GB:GENE:GENE rpsM LENGTH 118 SQ:AASEQ MARIAGVNIPVHKHTVIGLTSIYGIGKTRAQQICQTCNVDPTVKIKDLSEEQVESLRTEVAKFTVEGDLRREVSMDIKRLMDLGCFRGRRHRRSLPVRGQRTKTNARTRKGPRKPIKA GT:EXON 1|1-118:0| SW:ID RS13_FRATW SW:DE RecName: Full=30S ribosomal protein S13; SW:GN Name=rpsM; OrderedLocusNames=FTW_1736; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->118|RS13_FRATW|3e-65|100.0|118/118| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 87->100|PS00646|RIBOSOMAL_S13_1|PDOC00556| BL:PDB:NREP 1 BL:PDB:REP 2->116|2gy9M|5e-47|73.9|115/115| RP:PDB:NREP 1 RP:PDB:REP 2->116|3d5aM|3e-29|58.3|115/117| RP:PFM:NREP 1 RP:PFM:REP 3->108|PF00416|2e-25|60.4|106/107|Ribosomal_S13| HM:PFM:NREP 1 HM:PFM:REP 3->108|PF00416|4.6e-40|45.3|106/106|Ribosomal_S13| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF00416|IPR001892| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00416|IPR001892| GO:PFM GO:0005622|"GO:intracellular"|PF00416|IPR001892| GO:PFM GO:0005840|"GO:ribosome"|PF00416|IPR001892| GO:PFM GO:0006412|"GO:translation"|PF00416|IPR001892| RP:SCP:NREP 1 RP:SCP:REP 2->117|1fjgM|3e-28|57.8|116/125|a.156.1.1| HM:SCP:REP 2->120|1fjgM_|1.2e-41|52.9|119/125|a.156.1.1|1/1|S13-like H2TH domain| OP:NHOMO 1021 OP:NHOMOORG 996 OP:PATTERN ---------------------------------1111-----------------------1------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111112111111111111111111-11111111111111111111111111111111 ------------11111111111-1----1--1111-1111111-1--1111111111111-1111111211-11-111111111111----1--1-------1-1--2-------------------------------------------------1----------------1111E1111131-3122------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 99.2 SQ:SECSTR GccccTTcccccccHHHHHHHcTTccHHHHHHHHTTTTccccccGGGccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHTccHHHHHHHHTccccccccccccHHHHccccccc# DISOP:02AL 118-119| PSIPRED ccEEEccccccccEEEEEEEEHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccc //