[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsN
DDBJ      :rpsN         30S ribosomal protein S14
Swiss-Prot:RS14_FRATW   RecName: Full=30S ribosomal protein S14;

Homologs  Archaea  0/68 : Bacteria  789/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->101 1vs5N PDBj 6e-28 61.5 %
:RPS:PDB   2->101 3bbnN PDBj 1e-29 44.4 %
:RPS:SCOP  2->101 1vs5N1  g.39.1.7 * 2e-27 60.4 %
:HMM:SCOP  42->101 1fjgN_ g.39.1.7 * 4.1e-22 58.3 %
:RPS:PFM   46->100 PF00253 * Ribosomal_S14 2e-13 63.6 %
:HMM:PFM   47->100 PF00253 * Ribosomal_S14 2.9e-27 59.3 54/55  
:HMM:PFM   13->59 PF10805 * DUF2730 0.00066 26.1 46/106  
:BLT:SWISS 1->101 RS14_FRATW 1e-54 100.0 %
:PROS 62->85|PS00527|RIBOSOMAL_S14

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31336.1 GT:GENE rpsN GT:PRODUCT 30S ribosomal protein S14 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1632177..1632482) GB:FROM 1632177 GB:TO 1632482 GB:DIRECTION - GB:GENE rpsN GB:PRODUCT 30S ribosomal protein S14 GB:PROTEIN_ID ACD31336.1 GB:DB_XREF GI:187713039 GB:GENE:GENE rpsN LENGTH 101 SQ:AASEQ MAKKSMIQRELKREKLVAKYAQKRAEFKAIILDINSTEEQIWEAQIKLQKLPVNSSASRVQRRCKVTGRPHAVYRKFGLCRNKLREYAMAGDVPGLKKASW GT:EXON 1|1-101:0| SW:ID RS14_FRATW SW:DE RecName: Full=30S ribosomal protein S14; SW:GN Name=rpsN; OrderedLocusNames=FTW_1745; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->101|RS14_FRATW|1e-54|100.0|101/101| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 62->85|PS00527|RIBOSOMAL_S14|PDOC00456| BL:PDB:NREP 1 BL:PDB:REP 2->101|1vs5N|6e-28|61.5|96/96| RP:PDB:NREP 1 RP:PDB:REP 2->101|3bbnN|1e-29|44.4|99/99| RP:PFM:NREP 1 RP:PFM:REP 46->100|PF00253|2e-13|63.6|55/55|Ribosomal_S14| HM:PFM:NREP 2 HM:PFM:REP 47->100|PF00253|2.9e-27|59.3|54/55|Ribosomal_S14| HM:PFM:REP 13->59|PF10805|0.00066|26.1|46/106|DUF2730| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00253|IPR001209| GO:PFM GO:0005622|"GO:intracellular"|PF00253|IPR001209| GO:PFM GO:0005840|"GO:ribosome"|PF00253|IPR001209| GO:PFM GO:0006412|"GO:translation"|PF00253|IPR001209| RP:SCP:NREP 1 RP:SCP:REP 2->101|1vs5N1|2e-27|60.4|96/96|g.39.1.7| HM:SCP:REP 42->101|1fjgN_|4.1e-22|58.3|60/60|g.39.1.7|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 895 OP:NHOMOORG 811 OP:PATTERN -------------------------------------------------------------------- ---1111111111121222-221122222222211122221---21112111111111112212211222-11112111111------1111111111-1111111111111111111111111111111111111----------11111111111111111111-1111111111111111--1---1-1111111111111111111-111111111111111111111--22222222222221222222-21211212222222112211-2111112222111111111111112222222221221111---1112111111111111111111111111-1-111-1-1111------11111111-1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111------1----111----1---------1---11111111111--111111-----1--1111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------111111---1--1--------1-111-11--11111-11 11-----------1-----1------1----------11--11------------------------------1------1--------12-----------11-1--------------------------------------------------------------------21----------132--2------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 99.0 SQ:SECSTR #ccTTHHHHHHTTTccTTTTcccTTTTTTTTccccccccccccHHHHcccccccccGGGcccccccccccccccTTTcccTTHHHHHHTTTcccccccccc DISOP:02AL 101-102| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHEEcccccEEEccccHHHHHHHHHHHcccccccccccc //