[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsO
DDBJ      :rpsO         30S ribosomal protein S15
Swiss-Prot:RS15_FRATW   RecName: Full=30S ribosomal protein S15;

Homologs  Archaea  0/68 : Bacteria  891/915 : Eukaryota  39/199 : Viruses  0/175   --->[See Alignment]
a.16.1
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->88 2qalO PDBj 9e-28 65.5 %
:RPS:PDB   7->87 3bbnO PDBj 1e-24 40.7 %
:RPS:SCOP  2->86 1a32A  a.16.1.2 * 5e-24 55.3 %
:HMM:SCOP  1->88 1g1xB_ a.16.1.2 * 1.5e-33 63.6 %
:RPS:PFM   5->86 PF00312 * Ribosomal_S15 9e-19 67.1 %
:HMM:PFM   7->87 PF00312 * Ribosomal_S15 8e-32 55.6 81/83  
:BLT:SWISS 1->88 RS15_FRATW 3e-46 100.0 %
:PROS 38->68|PS00362|RIBOSOMAL_S15

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31222.1 GT:GENE rpsO GT:PRODUCT 30S ribosomal protein S15 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1489712..1489978) GB:FROM 1489712 GB:TO 1489978 GB:DIRECTION - GB:GENE rpsO GB:PRODUCT 30S ribosomal protein S15 GB:PROTEIN_ID ACD31222.1 GB:DB_XREF GI:187712925 GB:GENE:GENE rpsO LENGTH 88 SQ:AASEQ MLTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLQGHFEAHKKDNHSRRGLLRLVSQRRKLLDYLHDKDVERYRSLIKKLNIRR GT:EXON 1|1-88:0| SW:ID RS15_FRATW SW:DE RecName: Full=30S ribosomal protein S15; SW:GN Name=rpsO; OrderedLocusNames=FTW_1545; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|RS15_FRATW|3e-46|100.0|88/88| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 38->68|PS00362|RIBOSOMAL_S15|PDOC00313| BL:PDB:NREP 1 BL:PDB:REP 2->88|2qalO|9e-28|65.5|87/88| RP:PDB:NREP 1 RP:PDB:REP 7->87|3bbnO|1e-24|40.7|81/85| RP:PFM:NREP 1 RP:PFM:REP 5->86|PF00312|9e-19|67.1|82/83|Ribosomal_S15| HM:PFM:NREP 1 HM:PFM:REP 7->87|PF00312|8e-32|55.6|81/83|Ribosomal_S15| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00312|IPR000589| GO:PFM GO:0005622|"GO:intracellular"|PF00312|IPR000589| GO:PFM GO:0005840|"GO:ribosome"|PF00312|IPR000589| GO:PFM GO:0006412|"GO:translation"|PF00312|IPR000589| RP:SCP:NREP 1 RP:SCP:REP 2->86|1a32A|5e-24|55.3|85/85|a.16.1.2| HM:SCP:REP 1->88|1g1xB_|1.5e-33|63.6|88/88|a.16.1.2|1/1|S15/NS1 RNA-binding domain| OP:NHOMO 946 OP:NHOMOORG 930 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111-111111111111111111111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-111111111111111111111111111111111111111111111111111111-111111111111-111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111-111111111111111111111-11--11111111111-1111-1-11111111111111111111111111111111 ----11-1------1-----------------------------------------------1--1111-1-1---11-1-------1---1--------1-1112--------------------------------------------------------------------112117111221--2-1122----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 98.9 SQ:SECSTR #ccHHHHHHHHHHHcccccccccTTHHHHHHHHHHTTTTTTTTTcTTccTTcHHHHHHHHHHHHHHTTHHHHccHHHHTTTTTTTccc DISOP:02AL 88-89| PSIPRED cccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccc //