[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsP
DDBJ      :rpsP         30S ribosomal protein S16
Swiss-Prot:RS16_FRATW   RecName: Full=30S ribosomal protein S16;

Homologs  Archaea  0/68 : Bacteria  845/915 : Eukaryota  103/199 : Viruses  0/175   --->[See Alignment]
d.27.1
:82 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->82 1vs5P PDBj 2e-25 61.0 %
:RPS:PDB   1->79 3bbnP PDBj 8e-26 42.7 %
:RPS:SCOP  1->82 1vs5P1  d.27.1.1 * 2e-32 61.0 %
:HMM:SCOP  1->84 1fjgP_ d.27.1.1 * 2.6e-27 57.8 %
:RPS:PFM   8->68 PF00886 * Ribosomal_S16 1e-14 62.3 %
:HMM:PFM   8->68 PF00886 * Ribosomal_S16 6.2e-30 60.7 61/62  
:BLT:SWISS 1->82 RS16_FRATW 1e-42 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30295.1 GT:GENE rpsP GT:PRODUCT 30S ribosomal protein S16 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 240228..240476 GB:FROM 240228 GB:TO 240476 GB:DIRECTION + GB:GENE rpsP GB:PRODUCT 30S ribosomal protein S16 GB:PROTEIN_ID ACD30295.1 GB:DB_XREF GI:187711998 GB:GENE:GENE rpsP LENGTH 82 SQ:AASEQ MVVIRMARGGAKKRPFYRIVVADKRSPRDGRFIEKLGFFNPLAKGGEERLKLDVAKAEAWLAKGAQPSDRVASLIKEAKKAA GT:EXON 1|1-82:0| SW:ID RS16_FRATW SW:DE RecName: Full=30S ribosomal protein S16; SW:GN Name=rpsP; OrderedLocusNames=FTW_0240; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->82|RS16_FRATW|1e-42|100.0|82/82| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 1->82|1vs5P|2e-25|61.0|82/82| RP:PDB:NREP 1 RP:PDB:REP 1->79|3bbnP|8e-26|42.7|75/80| RP:PFM:NREP 1 RP:PFM:REP 8->68|PF00886|1e-14|62.3|61/62|Ribosomal_S16| HM:PFM:NREP 1 HM:PFM:REP 8->68|PF00886|6.2e-30|60.7|61/62|Ribosomal_S16| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00886|IPR000307| GO:PFM GO:0005622|"GO:intracellular"|PF00886|IPR000307| GO:PFM GO:0005840|"GO:ribosome"|PF00886|IPR000307| GO:PFM GO:0006412|"GO:translation"|PF00886|IPR000307| RP:SCP:NREP 1 RP:SCP:REP 1->82|1vs5P1|2e-32|61.0|82/82|d.27.1.1| HM:SCP:REP 1->84|1fjgP_|2.6e-27|57.8|83/83|d.27.1.1|1/1|Ribosomal protein S16| OP:NHOMO 998 OP:NHOMOORG 948 OP:PATTERN -------------------------------------------------------------------- 111111-111111-111----1--11-----11111-11111111111-111111-1111111111111111111---11111-111111111111-1111111-111111111111-------1111111111-1111111111111--11111------11-111---1-11----1--1-1111111-111111111111111111111111111111111111111111-1111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111--111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111-11111111111111111111111111111111-111111111111111121111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-1-1-1--1111111111111-1111111111111 ------1-----11111-1111-1111----------111111-----111111---111-1-11-11--1111--1-111-----------1----------112---1--212-1-1--11111-11351-121-----111111---111111--1---------------32112M1122242221231111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 100.0 SQ:SECSTR cEEEcccccccTTccccccccEETTcccccccccccccccTTTccccccccccTTTccccTTcccEEcTTTccccTTTTccc PSIPRED cEEEEEHHcccccccEEEEEEEEccccccccEEEEcccccccccccccEEEEEHHHHHHHHHccccccHHHHHHHHHHHHcc //