[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsQ
DDBJ      :rpsQ         30S ribosomal protein S17
Swiss-Prot:RS17_FRATW   RecName: Full=30S ribosomal protein S17;

Homologs  Archaea  0/68 : Bacteria  879/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:83 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->81 1vs7Q PDBj 3e-26 59.0 %
:RPS:PDB   6->83 3d5aQ PDBj 2e-21 41.0 %
:RPS:SCOP  4->81 1vs5Q1  b.40.4.5 * 2e-24 59.0 %
:HMM:SCOP  4->81 1i94Q_ b.40.4.5 * 1.7e-27 55.1 %
:RPS:PFM   10->78 PF00366 * Ribosomal_S17 1e-16 60.9 %
:HMM:PFM   10->77 PF00366 * Ribosomal_S17 2.2e-29 58.8 68/69  
:BLT:SWISS 1->83 RS17_FRATW 3e-46 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31340.1 GT:GENE rpsQ GT:PRODUCT 30S ribosomal protein S17 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1633850..1634101) GB:FROM 1633850 GB:TO 1634101 GB:DIRECTION - GB:GENE rpsQ GB:PRODUCT 30S ribosomal protein S17 GB:PROTEIN_ID ACD31340.1 GB:DB_XREF GI:187713043 GB:GENE:GENE rpsQ LENGTH 83 SQ:AASEQ MSDKIRLLEGKVSSVAMDKTVVVRAERYVKHPLYGKFVKKTTKYYVHDENNECKEGDVIKFKETRPYSKTKKWCLVDIIHREK GT:EXON 1|1-83:0| SW:ID RS17_FRATW SW:DE RecName: Full=30S ribosomal protein S17; SW:GN Name=rpsQ; OrderedLocusNames=FTW_1749; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->83|RS17_FRATW|3e-46|100.0|83/83| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 4->81|1vs7Q|3e-26|59.0|78/81| RP:PDB:NREP 1 RP:PDB:REP 6->83|3d5aQ|2e-21|41.0|78/99| RP:PFM:NREP 1 RP:PFM:REP 10->78|PF00366|1e-16|60.9|69/69|Ribosomal_S17| HM:PFM:NREP 1 HM:PFM:REP 10->77|PF00366|2.2e-29|58.8|68/69|Ribosomal_S17| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00366|IPR000266| GO:PFM GO:0005622|"GO:intracellular"|PF00366|IPR000266| GO:PFM GO:0005840|"GO:ribosome"|PF00366|IPR000266| GO:PFM GO:0006412|"GO:translation"|PF00366|IPR000266| RP:SCP:NREP 1 RP:SCP:REP 4->81|1vs5Q1|2e-24|59.0|78/80|b.40.4.5| HM:SCP:REP 4->81|1i94Q_|1.7e-27|55.1|78/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 924 OP:NHOMOORG 899 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111112-11-111111111111111111111111-11111111111112-1111111111-11111111111111111111111111111---11111--111111111111111-1--111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-1--1-11111111-111111-1111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111-1111111111111111111111111111111111-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111-1111111-111111----1111111111111111111111 --------1----------------------------------------------------------------1-------------------------1-----1---------------------------------------------------------------------11-1G111223112-21--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 96.4 SQ:SECSTR ###cccEEEEEEEEcccccEEEEEEEEEEEcTTTccEEEEEEEEEEEcTTccccTTcEEEEEEEEEEETTEEEEEEEEEEccc PSIPRED cccccEEEEEEEEEcccccEEEEEEEEEEEcccccEEEEEEEEEEEEcHHHccccccEEEEEEEccccccEEEEEEEEEEccc //