[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsR
DDBJ      :rpsR         30S ribosomal protein S18
Swiss-Prot:RS18_FRATW   RecName: Full=30S ribosomal protein S18;

Homologs  Archaea  0/68 : Bacteria  883/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.8
:72 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->70 2gy9R PDBj 5e-28 79.4 %
:RPS:PDB   15->70 3bbnR PDBj 4e-21 39.3 %
:RPS:SCOP  3->70 1fjgR  a.4.8.1 * 1e-25 45.6 %
:HMM:SCOP  3->73 1i94R_ a.4.8.1 * 3.3e-24 56.3 %
:RPS:PFM   14->64 PF01084 * Ribosomal_S18 1e-12 64.7 %
:HMM:PFM   13->64 PF01084 * Ribosomal_S18 7.4e-29 61.5 52/54  
:BLT:SWISS 1->72 RS18_FRATW 4e-38 100.0 %
:PROS 17->40|PS00057|RIBOSOMAL_S18

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30830.1 GT:GENE rpsR GT:PRODUCT 30S ribosomal protein S18 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 973417..973635 GB:FROM 973417 GB:TO 973635 GB:DIRECTION + GB:GENE rpsR GB:PRODUCT 30S ribosomal protein S18 GB:PROTEIN_ID ACD30830.1 GB:DB_XREF GI:187712533 GB:GENE:GENE rpsR LENGTH 72 SQ:AASEQ MSRRKVCRFTVEGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLALLPYCDRHFN GT:EXON 1|1-72:0| SW:ID RS18_FRATW SW:DE RecName: Full=30S ribosomal protein S18; SW:GN Name=rpsR; OrderedLocusNames=FTW_0971; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->72|RS18_FRATW|4e-38|100.0|72/72| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 17->40|PS00057|RIBOSOMAL_S18|PDOC00056| BL:PDB:NREP 1 BL:PDB:REP 3->70|2gy9R|5e-28|79.4|68/69| RP:PDB:NREP 1 RP:PDB:REP 15->70|3bbnR|4e-21|39.3|56/58| RP:PFM:NREP 1 RP:PFM:REP 14->64|PF01084|1e-12|64.7|51/54|Ribosomal_S18| HM:PFM:NREP 1 HM:PFM:REP 13->64|PF01084|7.4e-29|61.5|52/54|Ribosomal_S18| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01084|IPR001648| GO:PFM GO:0005622|"GO:intracellular"|PF01084|IPR001648| GO:PFM GO:0005840|"GO:ribosome"|PF01084|IPR001648| GO:PFM GO:0006412|"GO:translation"|PF01084|IPR001648| RP:SCP:NREP 1 RP:SCP:REP 3->70|1fjgR|1e-25|45.6|68/73|a.4.8.1| HM:SCP:REP 3->73|1i94R_|3.3e-24|56.3|71/82|a.4.8.1|1/1|Ribosomal protein S18| OP:NHOMO 910 OP:NHOMOORG 883 OP:PATTERN -------------------------------------------------------------------- 1111111111111121222-221122222222111122221--11-111111111111--11112121121111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111-111111111111111111111111-11-111111111111111111111111111111111-11111111111112-11111111111111111111111111111111111111111111111111--1111111111111111-11111111111111111111111111111111111121111111111111111111111111111111111111111-1111111-11111-111111111111111111--111111111-1111111-1-11111111111111111111111111111111111-1111111111111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-111111111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 95.8 SQ:SECSTR #cccccTTTccccccccccccHHHHTTTccccccccccccTTccTTTTTTTHHHHHHHTTTTcccTTccc## PSIPRED cccccccHHHHccccccccccHHHHHHHccccccEEccccccccHHHHHHHHHHHHHHHHHccccccccccc //