[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsS
DDBJ      :rpsS         30S ribosomal protein S19
Swiss-Prot:RS19_FRATW   RecName: Full=30S ribosomal protein S19;

Homologs  Archaea  44/68 : Bacteria  900/915 : Eukaryota  75/199 : Viruses  0/175   --->[See Alignment]
d.28.1
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->88 2gy9S PDBj 8e-38 78.2 %
:RPS:PDB   1->92 3bbnS PDBj 2e-30 53.3 %
:RPS:SCOP  2->84 1fjgS  d.28.1.1 * 4e-32 69.9 %
:HMM:SCOP  2->85 1fjgS_ d.28.1.1 * 8.1e-33 58.3 %
:RPS:PFM   3->83 PF00203 * Ribosomal_S19 1e-25 71.6 %
:HMM:PFM   3->83 PF00203 * Ribosomal_S19 4.3e-40 63.0 81/81  
:BLT:SWISS 1->92 RS19_FRATW 5e-51 100.0 %
:PROS 53->77|PS00323|RIBOSOMAL_S19

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31345.1 GT:GENE rpsS GT:PRODUCT 30S ribosomal protein S19 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1635764..1636042) GB:FROM 1635764 GB:TO 1636042 GB:DIRECTION - GB:GENE rpsS GB:PRODUCT 30S ribosomal protein S19 GB:PROTEIN_ID ACD31345.1 GB:DB_XREF GI:187713048 GB:GENE:GENE rpsS LENGTH 92 SQ:AASEQ MPRSLKKGPFVDHHLLKKVFEAQESNSKKPIKTWSRRSMIVPDMIGLTIAVHNGQQHVPVLMTEEMVGHKLGEFVVTRNYRGHAADKKAKKK GT:EXON 1|1-92:0| SW:ID RS19_FRATW SW:DE RecName: Full=30S ribosomal protein S19; SW:GN Name=rpsS; OrderedLocusNames=FTW_1753; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->92|RS19_FRATW|5e-51|100.0|92/92| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 53->77|PS00323|RIBOSOMAL_S19|PDOC00288| BL:PDB:NREP 1 BL:PDB:REP 2->88|2gy9S|8e-38|78.2|87/87| RP:PDB:NREP 1 RP:PDB:REP 1->92|3bbnS|2e-30|53.3|92/92| RP:PFM:NREP 1 RP:PFM:REP 3->83|PF00203|1e-25|71.6|81/81|Ribosomal_S19| HM:PFM:NREP 1 HM:PFM:REP 3->83|PF00203|4.3e-40|63.0|81/81|Ribosomal_S19| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00203|IPR002222| GO:PFM GO:0005622|"GO:intracellular"|PF00203|IPR002222| GO:PFM GO:0005840|"GO:ribosome"|PF00203|IPR002222| GO:PFM GO:0006412|"GO:translation"|PF00203|IPR002222| RP:SCP:NREP 1 RP:SCP:REP 2->84|1fjgS|4e-32|69.9|83/84|d.28.1.1| HM:SCP:REP 2->85|1fjgS_|8.1e-33|58.3|84/84|d.28.1.1|1/1|Ribosomal protein S19| OP:NHOMO 1037 OP:NHOMOORG 1019 OP:PATTERN 11111111111111111111111-111--1-1---11-------------111-1111111---1111 1111111-11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-111111111111111-111111111111-1111111111111111111111111111111111111111111111111-11111-11111111111111111111-111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 -1----------11-111-1-1-111--------11-111111---11111111--1-11111---1-1-111-111111-1111111-1111-1411111-1111--------------------------------------------------------------------1111--------1-A112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 92 STR:RPRED 100.0 SQ:SECSTR ccccccccccccHHHHHHHHTTTTTTccccEEEccccccccTTcTTccEEEEccccEEEEcccccccccccTTTcccccccccccccccccc DISOP:02AL 92-93| PSIPRED ccccccccccccHHHHHHHHHHHcccccccEEEEEccccccHHHcccEEEEEcccEEEEEEEccccEEcccccccccccccccccccccccc //