[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : rpsT
DDBJ      :rpsT         ribosomal protein S20
Swiss-Prot:RS20_FRATW   RecName: Full=30S ribosomal protein S20;

Homologs  Archaea  0/68 : Bacteria  483/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.7.6
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->87 1vs5T PDBj 1e-25 61.2 %
:RPS:PDB   7->86 3bbnT PDBj 5e-07 35.0 %
:RPS:SCOP  4->90 1fjgT  a.7.6.1 * 2e-19 36.8 %
:HMM:SCOP  3->86 1fjgT_ a.7.6.1 * 1e-27 56.0 %
:RPS:PFM   2->85 PF01649 * Ribosomal_S20p 4e-04 56.0 %
:HMM:PFM   2->84 PF01649 * Ribosomal_S20p 1.7e-31 51.8 83/84  
:BLT:SWISS 1->90 RS20_FRATW 5e-46 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30154.1 GT:GENE rpsT GT:PRODUCT ribosomal protein S20 GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(46733..47005) GB:FROM 46733 GB:TO 47005 GB:DIRECTION - GB:GENE rpsT GB:PRODUCT ribosomal protein S20 GB:PROTEIN_ID ACD30154.1 GB:DB_XREF GI:187711857 GB:GENE:GENE rpsT LENGTH 90 SQ:AASEQ MANSKQAKKRIIQAERNRQHNVARRSMMRTFLKKTAYAIEKGDVEAAKENFAKVVPILDKYASKGLIHKNKAARHKSRLSAKIKALATAA GT:EXON 1|1-90:0| SW:ID RS20_FRATW SW:DE RecName: Full=30S ribosomal protein S20; SW:GN Name=rpsT; OrderedLocusNames=FTW_1938; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->90|RS20_FRATW|5e-46|100.0|90/90| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 3->87|1vs5T|1e-25|61.2|85/85| RP:PDB:NREP 1 RP:PDB:REP 7->86|3bbnT|5e-07|35.0|80/102| RP:PFM:NREP 1 RP:PFM:REP 2->85|PF01649|4e-04|56.0|84/84|Ribosomal_S20p| HM:PFM:NREP 1 HM:PFM:REP 2->84|PF01649|1.7e-31|51.8|83/84|Ribosomal_S20p| GO:PFM:NREP 5 GO:PFM GO:0003723|"GO:RNA binding"|PF01649|IPR002583| GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01649|IPR002583| GO:PFM GO:0005622|"GO:intracellular"|PF01649|IPR002583| GO:PFM GO:0005840|"GO:ribosome"|PF01649|IPR002583| GO:PFM GO:0006412|"GO:translation"|PF01649|IPR002583| RP:SCP:NREP 1 RP:SCP:REP 4->90|1fjgT|2e-19|36.8|87/99|a.7.6.1| HM:SCP:REP 3->86|1fjgT_|1e-27|56.0|84/99|a.7.6.1|1/1|Ribosomal protein S20| OP:NHOMO 485 OP:NHOMOORG 485 OP:PATTERN -------------------------------------------------------------------- 1-1-1------1-1-11----1--1------11--------111-111----111111--1111-11---1-------1------1---------------------1---111111-------------------111------1-----------111-1---------11-11111-111---11-1-1111111111111111111---11111111-111------1----------------------1----------------------------------1-1--11---1-------------1--------------1111111-1-----1---1--11----1--1----11-111-111--1-11-111-111111--1--11111111111111---------1-111111-1-11111---11111----1111111111111111-11--------11---------------1111---1-111111------11111----111111-------------1-111--11---11111111111111111111-1---1----------1-1-11-1------11-----------111111111--1--111111111111111111111111111111111-1111111-1111111-111111111-11-11111111111111111111111111111111111111111111111-11111111111111111-111111111111111-11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-----------------------------------------1-111-11---- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 97.8 SQ:SECSTR ##cccTccHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHTTccccccccTTHHHHHHHHHTTHHHHccTTT DISOP:02AL 90-91| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccc //