[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : secE
DDBJ      :secE         preprotein translocase, subunit E, membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   96->146 3bo0B PDBj 2e-07 43.8 %
:RPS:PFM   102->151 PF00584 * SecE 2e-04 40.0 %
:HMM:PFM   99->155 PF00584 * SecE 1.4e-19 38.6 57/57  
:HMM:PFM   35->78 PF07666 * MpPF26 8.5e-05 25.0 44/130  
:BLT:SWISS 94->145 SECE_VIBCH 1e-05 42.0 %
:PROS 103->131|PS01067|SECE_SEC61G
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30283.1 GT:GENE secE GT:PRODUCT preprotein translocase, subunit E, membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 224036..224506 GB:FROM 224036 GB:TO 224506 GB:DIRECTION + GB:GENE secE GB:PRODUCT preprotein translocase, subunit E, membrane protein GB:PROTEIN_ID ACD30283.1 GB:DB_XREF GI:187711986 GB:GENE:GENE secE LENGTH 156 SQ:AASEQ MPVYKLFFLKDCFVKRNQGFNNNKVWISGATKTTEVKKISKSNNLMLWLAVVAIIVLGVAVTMYSDILGDSYSTYNTSLAVVVVLLAVVVARFTNQGRRFWAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFLG GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 94->145|SECE_VIBCH|1e-05|42.0|50/126| PROS 103->131|PS01067|SECE_SEC61G|PDOC00818| TM:NTM 3 TM:REGION 43->65| TM:REGION 79->97| TM:REGION 128->150| SEG 49->61|lavvaiivlgvav| SEG 79->91|lavvvvllavvva| SEG 129->135|vivvvii| RP:PDB:NREP 1 RP:PDB:REP 96->146|3bo0B|2e-07|43.8|48/65| RP:PFM:NREP 1 RP:PFM:REP 102->151|PF00584|2e-04|40.0|50/57|SecE| HM:PFM:NREP 2 HM:PFM:REP 99->155|PF00584|1.4e-19|38.6|57/57|SecE| HM:PFM:REP 35->78|PF07666|8.5e-05|25.0|44/130|MpPF26| GO:PFM:NREP 3 GO:PFM GO:0006605|"GO:protein targeting"|PF00584|IPR001901| GO:PFM GO:0006886|"GO:intracellular protein transport"|PF00584|IPR001901| GO:PFM GO:0016020|"GO:membrane"|PF00584|IPR001901| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 39.1 SQ:SECSTR ###############################################################################################HHHHHHHHHHHHHHHHHHHccTTTTTcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 18-28,31-32| PSIPRED cccHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //