[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : secF
DDBJ      :secF         preprotein translocase, subunit F, membrane protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  796/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.35.1
:314 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  122->285 1iwgA7  f.35.1.1 * 3e-20 14.1 %
:HMM:SCOP  70->300 1iwgA8 f.35.1.1 * 1.1e-34 20.2 %
:RPS:PFM   129->285 PF02355 * SecD_SecF 4e-39 49.7 %
:HMM:PFM   118->294 PF02355 * SecD_SecF 1.5e-66 49.7 177/189  
:HMM:PFM   33->58 PF07549 * Sec_GG 1.3e-09 42.3 26/29  
:HMM:PFM   55->80 PF04361 * DUF494 0.00079 38.5 26/155  
:BLT:SWISS 11->309 SECF_ECOLI 1e-59 39.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31137.1 GT:GENE secF GT:PRODUCT preprotein translocase, subunit F, membrane protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1370447..1371391) GB:FROM 1370447 GB:TO 1371391 GB:DIRECTION - GB:GENE secF GB:PRODUCT preprotein translocase, subunit F, membrane protein GB:PROTEIN_ID ACD31137.1 GB:DB_XREF GI:187712840 GB:GENE:GENE secF LENGTH 314 SQ:AASEQ MEFFKQKTSIDFLGIKKYTTVFSVLMIVVSLFFIFTKGLNLGLDFTGGYQVQIQTSTKSQDSETMTKELAKAGFEHTTITTFGDNNNFLIKFAPDEVNTKAKSLEDAQQYLKQQVENSLDAQVQSVNYIGPQVGKELASNGVLAIIVAMVCILIYISARFEMKFGISACIALLHDPIVILGIFSAFQLEFDLTVLAAVLAVIGYSLNDTVVIYDRVRENFRKIRNASVVEVVNRSINDTLSRTILTSGLTMLVVVVLYLFGGSSVHNFSLAIILGIVVGTYSSIYVAGVVAVALGLNRESLLPKQVSKEDIPIL GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 11->309|SECF_ECOLI|1e-59|39.5|296/323| TM:NTM 5 TM:REGION 18->40| TM:REGION 137->158| TM:REGION 174->196| TM:REGION 244->266| TM:REGION 275->297| SEG 286->296|vagvvavalgl| RP:PFM:NREP 1 RP:PFM:REP 129->285|PF02355|4e-39|49.7|157/185|SecD_SecF| HM:PFM:NREP 3 HM:PFM:REP 118->294|PF02355|1.5e-66|49.7|177/189|SecD_SecF| HM:PFM:REP 33->58|PF07549|1.3e-09|42.3|26/29|Sec_GG| HM:PFM:REP 55->80|PF04361|0.00079|38.5|26/155|DUF494| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF02355|IPR003335| GO:PFM GO:0015627|"GO:type II protein secretion system complex"|PF02355|IPR003335| GO:PFM GO:0015628|"GO:protein secretion by the type II secretion system"|PF02355|IPR003335| RP:SCP:NREP 1 RP:SCP:REP 122->285|1iwgA7|3e-20|14.1|163/199|f.35.1.1| HM:SCP:REP 70->300|1iwgA8|1.1e-34|20.2|218/223|f.35.1.1|1/1|Multidrug efflux transporter AcrB transmembrane domain| OP:NHOMO 1095 OP:NHOMOORG 803 OP:PATTERN -------------------------11----------------1------------------------ 1111111111111111111-11111111111111111111111111111111-111111111111111221--------111111212111111111--111111111211111111111111111-1112111121111111111211111221111111111111111111111111111111111112211111111111111111221111111111111-1111111111111111111111111111----------------------------------------------------------------------12-2211111111112-112222112--1111111221111221111111111122111111112222121112222222222222-22222221111121122222222211121122222222211111111-1-211321111111121222222222221221212112121111111111111111111111111111111111111111112221111212112111111111111111111111111212211121212211211111111112111211111122222222211112112223211123233333224333323443331-21222------12212121111111111-1111111111111111111222222222222222222222222111111112-211111111111111222222211112211222222222122221222322211112222211112111121112222222222122212222224222221212222222222221111221111111122----------11--111----11---1211122212111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1-1--2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 314-315| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccEEEEEEEccccccHHHHHHHHHHccccccEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccccccc //