[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : smpB
DDBJ      :smpB         SsrA (tmRNA)-binding protein
Swiss-Prot:SSRP_FRATW   RecName: Full=SsrA-binding protein;

Homologs  Archaea  0/68 : Bacteria  897/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
b.111.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->135 1k8hA PDBj 6e-27 48.4 %
:RPS:PDB   9->130 2czjA PDBj 3e-45 44.6 %
:RPS:SCOP  10->131 1p6vA  b.111.1.1 * 4e-46 55.1 %
:HMM:SCOP  3->135 1k8hA_ b.111.1.1 * 9.7e-51 53.0 %
:RPS:PFM   10->77 PF01668 * SmpB 9e-21 64.7 %
:HMM:PFM   10->75 PF01668 * SmpB 1.1e-32 59.1 66/68  
:BLT:SWISS 1->157 SSRP_FRATW 1e-89 100.0 %
:PROS 29->41|PS01317|SSRP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30762.1 GT:GENE smpB GT:PRODUCT SsrA (tmRNA)-binding protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(872546..873019) GB:FROM 872546 GB:TO 873019 GB:DIRECTION - GB:GENE smpB GB:PRODUCT SsrA (tmRNA)-binding protein GB:PROTEIN_ID ACD30762.1 GB:DB_XREF GI:187712465 GB:GENE:GENE smpB LENGTH 157 SQ:AASEQ MSKHKVSPATIAKNKKALHDYTILEKFEAGIVLQGWEVKSIRAGKVQMVDSHVHIKHGEAWLFNCLITPLLSASTHVVADAAATRKLLLNRREINKIMGRIEQKGFTCIPLSMYWKGPRVKVEIALAQGKKVHDKRQAQKDKDWAREKDRLFKKAYK GT:EXON 1|1-157:0| SW:ID SSRP_FRATW SW:DE RecName: Full=SsrA-binding protein; SW:GN Name=smpB; OrderedLocusNames=FTW_1234; SW:KW Complete proteome; Cytoplasm; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|SSRP_FRATW|1e-89|100.0|157/157| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| PROS 29->41|PS01317|SSRP|PDOC01021| BL:PDB:NREP 1 BL:PDB:REP 11->135|1k8hA|6e-27|48.4|124/133| RP:PDB:NREP 1 RP:PDB:REP 9->130|2czjA|3e-45|44.6|121/122| RP:PFM:NREP 1 RP:PFM:REP 10->77|PF01668|9e-21|64.7|68/69|SmpB| HM:PFM:NREP 1 HM:PFM:REP 10->75|PF01668|1.1e-32|59.1|66/68|SmpB| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01668|IPR000037| GO:PFM GO:0006412|"GO:translation"|PF01668|IPR000037| RP:SCP:NREP 1 RP:SCP:REP 10->131|1p6vA|4e-46|55.1|118/125|b.111.1.1| HM:SCP:REP 3->135|1k8hA_|9.7e-51|53.0|132/133|b.111.1.1|1/1|Small protein B (SmpB)| OP:NHOMO 909 OP:NHOMOORG 904 OP:PATTERN -------------------------------------------------------------------- 111111111111111-111-11111111111111111111111111111111111111111111111111111111111111111111111111111---1--111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111-1111111---11111-1111111111-11111 ------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------11----------------111---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 80.9 SQ:SECSTR ########cccEEcHHHHTTcccccEEEEEcccccHHHHHHHccccccTTcEEEEccccEEEEcccccTTccccccccccccccEEccccHHHHHHHHHTTTTTTcccEEEEEEETTccEEEEEEcccccccccc###################### DISOP:02AL 157-158| PSIPRED ccccccccccEEEcccEEccEEEEEEEEccEEEEHHHHHHHHHccccEEEEEEEEEccEEEEEEcccccHHccccEEcccccccHHHHHcHHHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcc //