[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : sodB
DDBJ      :sodB         iron/manganese superoxide dismutase family protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  766/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
a.2.11d.352.1d.44.1
:192 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->192 3h1sB PDBj e-115 100.0 %
:RPS:PDB   3->191 2bpiA PDBj 4e-76 50.8 %
:RPS:SCOP  5->107 2hc5A1  d.352.1.1 * 5e-28 11.0 %
:RPS:SCOP  87->191 1ap5A2  d.44.1.1 * 3e-27 40.0 %
:HMM:SCOP  1->83 1gv3A1 a.2.11.1 * 1.2e-35 54.2 %
:HMM:SCOP  83->194 1ma1A2 d.44.1.1 * 8.6e-42 51.8 %
:RPS:PFM   3->82 PF00081 * Sod_Fe_N 5e-23 58.8 %
:RPS:PFM   87->189 PF02777 * Sod_Fe_C 3e-33 59.2 %
:HMM:PFM   88->190 PF02777 * Sod_Fe_C 2.2e-45 58.3 103/106  
:HMM:PFM   2->81 PF00081 * Sod_Fe_N 2.4e-35 51.2 80/82  
:BLT:SWISS 1->190 SODF_PSEPU 4e-76 66.3 %
:PROS 156->163|PS00088|SOD_MN

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30230.1 GT:GENE sodB GT:PRODUCT iron/manganese superoxide dismutase family protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 142010..142588 GB:FROM 142010 GB:TO 142588 GB:DIRECTION + GB:GENE sodB GB:PRODUCT iron/manganese superoxide dismutase family protein GB:PROTEIN_ID ACD30230.1 GB:DB_XREF GI:187711933 GB:GENE:GENE sodB LENGTH 192 SQ:AASEQ MKFELPKLPYAVDALESTISKETIEYHYGKHHQTYVTNLNNLVEGTEHDGRNLEEIVKTSNGGIFNNAAQVFNHTFYWNCLTPNKTEASSQLKAALIETFGSVENFKEQFSKAAIATFGSGWAWLVKNTEGKLEIVTTSNAGCPLTENKKPLLTFDVWEHAYYIDYRNARPKYVEALWDIVNWQFVSEQFAD GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 1->190|SODF_PSEPU|4e-76|66.3|190/198| PROS 156->163|PS00088|SOD_MN|PDOC00083| BL:PDB:NREP 1 BL:PDB:REP 1->192|3h1sB|e-115|100.0|192/192| RP:PDB:NREP 1 RP:PDB:REP 3->191|2bpiA|4e-76|50.8|189/197| RP:PFM:NREP 2 RP:PFM:REP 3->82|PF00081|5e-23|58.8|80/82|Sod_Fe_N| RP:PFM:REP 87->189|PF02777|3e-33|59.2|103/104|Sod_Fe_C| HM:PFM:NREP 2 HM:PFM:REP 88->190|PF02777|2.2e-45|58.3|103/106|Sod_Fe_C| HM:PFM:REP 2->81|PF00081|2.4e-35|51.2|80/82|Sod_Fe_N| GO:PFM:NREP 8 GO:PFM GO:0004784|"GO:superoxide dismutase activity"|PF00081|IPR019831| GO:PFM GO:0006801|"GO:superoxide metabolic process"|PF00081|IPR019831| GO:PFM GO:0046872|"GO:metal ion binding"|PF00081|IPR019831| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00081|IPR019831| GO:PFM GO:0004784|"GO:superoxide dismutase activity"|PF02777|IPR019832| GO:PFM GO:0006801|"GO:superoxide metabolic process"|PF02777|IPR019832| GO:PFM GO:0046872|"GO:metal ion binding"|PF02777|IPR019832| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02777|IPR019832| RP:SCP:NREP 2 RP:SCP:REP 5->107|2hc5A1|5e-28|11.0|100/109|d.352.1.1| RP:SCP:REP 87->191|1ap5A2|3e-27|40.0|105/115|d.44.1.1| HM:SCP:REP 1->83|1gv3A1|1.2e-35|54.2|83/102|a.2.11.1|1/1|Fe,Mn superoxide dismutase (SOD), N-terminal domain| HM:SCP:REP 83->194|1ma1A2|8.6e-42|51.8|112/113|d.44.1.1|1/1|Fe,Mn superoxide dismutase (SOD), C-terminal domain| OP:NHOMO 1517 OP:NHOMOORG 989 OP:PATTERN 11----1111111111-1------12211211--1--------2--111-111--------111--12 111--11111111121111-1-1112111111-1111211-111112-111111111111---11121211-----------111-111111-1111--112211312121111111111111111111111112111111---2121222221111----1111222231------------11111---122333333333333333322222333222111111111131122222222222222111111---11-----------1-----11111111111111111111111111111111111111111111111-1--2222221222211112111111--2--1122-111-1-1------1211122111111111111121212211111111112-111112111111133111111111211211111111111111111111111112111111111111111111111111111111-11211122221111111111111111111111511111-111111211212121111211121-1111111111112---1-31-1-111--1---11----1-11121111111111111111111112-----2211111211111111111111111111111-1111111-11121111212222222222-222222222222222222222211212222222222222222222222222112222222222221111111111111211211111111111111111111113111122222222212222122211111111111112222222222233232333332222---111----11111111--11112-----------------------1-------121 2211221-D55-8B233223333332333332322212222223332233333324323333222-1111112121111112221133-4533223111111221211242131112111-13-11111483-3131-1111111111--2111111121112311111331233367171115633862732342212 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 100.0 SQ:SECSTR cccccccccccTTTTTTTccHHHHHHHHHTHHHHHHHHHHHHHTTcTTTTccHHHHHHHccHHHHHHHHHHHHHHHHHHTccTTcccccTHHHHHHHHHHccHHHHHHHHHHHHHHccccEEEEEEEcTTccEEEEEEETTccHHHHccEEEEEEEccGGGTHHHHTTcHHHHHHHHTTTccHHHHHHHHHc PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEEEEccccccccccEEEEEEEHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHcc //