[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : sohB
DDBJ      :sohB         peptidase family S49 protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  567/915 : Eukaryota  18/199 : Viruses  1/175   --->[See Alignment]
c.14.1
:338 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   99->291 3bf0D PDBj 4e-18 32.6 %
:RPS:PDB   102->291 3bezA PDBj 1e-33 27.6 %
:RPS:SCOP  95->286 1tg6A1  c.14.1.1 * 3e-10 17.5 %
:HMM:SCOP  80->291 1tyfA_ c.14.1.1 * 2.9e-31 30.3 %
:RPS:PFM   95->150 PF08496 * Peptidase_S49_N 8e-19 64.3 %
:RPS:PFM   152->299 PF01343 * Peptidase_S49 6e-23 37.2 %
:HMM:PFM   8->150 PF08496 * Peptidase_S49_N 1.6e-44 48.6 138/155  
:HMM:PFM   154->300 PF01343 * Peptidase_S49 6e-41 34.9 146/154  
:BLT:SWISS 95->312 SOHB_HAEIN 2e-70 55.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31274.1 GT:GENE sohB GT:PRODUCT peptidase family S49 protein GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1554064..1555080) GB:FROM 1554064 GB:TO 1555080 GB:DIRECTION - GB:GENE sohB GB:PRODUCT peptidase family S49 protein GB:PROTEIN_ID ACD31274.1 GB:DB_XREF GI:187712977 GB:GENE:GENE sohB LENGTH 338 SQ:AASEQ MWYQSFIGFVFFALSTVLVVAAIAIVIGSFFSLLSKAKQEAANLAKGRLEINEVATEYKHTKQQLLESLLEKKEYKKFLKEQKKLDKQDKPKQKIFVINFKGDIDASQVENLRNEVSAILAVANTEDEIIVRIDSPGGVVNGYGFAAAQLERIRQAGINLTVCIDQVAASGGYMMSAVAHKIIAAPFAIVGSIGVVGTIPNIRELLEKNGINVEMHTSGEYKRTLTTVGVNTEEGRNKFKQDLESIHQLFKKHILVYRPSLDIDKVATGEYWFGKDALELGLVDKIQTYDDYLIDLLKKQHNVYEVSYVIKKEKGFLRSKFSMLKRAITNLLYARKII GT:EXON 1|1-338:0| BL:SWS:NREP 1 BL:SWS:REP 95->312|SOHB_HAEIN|2e-70|55.3|217/353| TM:NTM 1 TM:REGION 9->31| SEG 19->27|vvaaiaivi| SEG 62->94|kqqllesllekkeykkflkeqkkldkqdkpkqk| BL:PDB:NREP 1 BL:PDB:REP 99->291|3bf0D|4e-18|32.6|181/476| RP:PDB:NREP 1 RP:PDB:REP 102->291|3bezA|1e-33|27.6|185/465| RP:PFM:NREP 2 RP:PFM:REP 95->150|PF08496|8e-19|64.3|56/155|Peptidase_S49_N| RP:PFM:REP 152->299|PF01343|6e-23|37.2|148/153|Peptidase_S49| HM:PFM:NREP 2 HM:PFM:REP 8->150|PF08496|1.6e-44|48.6|138/155|Peptidase_S49_N| HM:PFM:REP 154->300|PF01343|6e-41|34.9|146/154|Peptidase_S49| GO:PFM:NREP 4 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF08496|IPR013703| GO:PFM GO:0005886|"GO:plasma membrane"|PF08496|IPR013703| GO:PFM GO:0006508|"GO:proteolysis"|PF01343|IPR002142| GO:PFM GO:0008233|"GO:peptidase activity"|PF01343|IPR002142| RP:SCP:NREP 1 RP:SCP:REP 95->286|1tg6A1|3e-10|17.5|160/184|c.14.1.1| HM:SCP:REP 80->291|1tyfA_|2.9e-31|30.3|175/183|c.14.1.1|1/1|ClpP/crotonase| OP:NHOMO 846 OP:NHOMOORG 604 OP:PATTERN ----------------1-----------2-1---11111--1-11------1---1--1-1-11-1-- -11-----------1------1--1------1------1--111--------------------111---1-----------1111111111-1111--1111-1111-11111111--------11111111111---11----12221222221111111122112222111111111111---11--1--1---------------111111---1-11---1111111-1------------------1-----------------------------------------------------------------------------------------------11-1--11---111-2----1--2211-1111-1--1111222211111111111211112-112112111121111-111111-1-1-11-1112111-1--------1111-122--11-11111111-111111-1111----111111-----11121111111111-11111111-1111111111-1---1----111211111111111111122121-21--11-2112--1-11221122221-121111111111111111111111111112222222222322222222222222222221-1212111111122222222222222222-222222222222212222222222222222222222222222222222222212222222222221122222222222121112222222221-22221111111112122222111122111211111111111112222222223222211111111111111--71223322--------1--------------------------------------1- ----1-1-------1---------------------------------------------------------------------------------------------3----------------------------------------------------------------231-11511-33---1---34----3 ------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ STR:NPRED 205 STR:RPRED 60.7 SQ:SECSTR ##############################################################################################EcccccTcccTTcEEHHHHHHHHHHHHHcTTEEEEEEEEEEccccHHHHHHHHHHHHHHHHTTccEcEEEEEEEETHHHHTTTTccEEEEcTTcEEEcccEEEEEEEcHHHHHHTTcccccccccGGGcccTTccTccccHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHTTcTTcEEEHHHHHHTTcccEEccHHHHHHHHTTT####################################### PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHcccEEEEccccccccccEEEEcccHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEcHHHHHHcccccccccHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcc //