[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : sucD
DDBJ      :sucD         succinyl-CoA ligase [ADP-forming] subunit alpha
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  672/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.23.4
:290 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->287 1jkjA PDBj 1e-90 67.5 %
:RPS:PDB   2->287 1cqjA PDBj 1e-43 63.6 %
:RPS:SCOP  2->122 1cqiA1  c.2.1.8 * 5e-21 65.3 %
:RPS:SCOP  123->287 1cqiA2  c.23.4.1 * 6e-38 62.4 %
:HMM:SCOP  1->122 1eucA1 c.2.1.8 * 1e-50 53.3 %
:HMM:SCOP  123->289 1oi7A2 c.23.4.1 * 2e-62 44.3 %
:RPS:PFM   9->99 PF02629 * CoA_binding 1e-10 45.1 %
:RPS:PFM   151->258 PF00549 * Ligase_CoA 7e-08 35.2 %
:HMM:PFM   6->99 PF02629 * CoA_binding 7.5e-32 38.3 94/96  
:HMM:PFM   151->270 PF00549 * Ligase_CoA 6.3e-23 35.8 120/153  
:BLT:SWISS 1->290 SUCD_PSEAE e-100 71.4 %
:PROS 236->249|PS00399|SUCCINYL_COA_LIG_2
:PROS 152->181|PS01216|SUCCINYL_COA_LIG_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31236.1 GT:GENE sucD GT:PRODUCT succinyl-CoA ligase [ADP-forming] subunit alpha GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1507875..1508747 GB:FROM 1507875 GB:TO 1508747 GB:DIRECTION + GB:GENE sucD GB:PRODUCT succinyl-CoA ligase [ADP-forming] subunit alpha GB:PROTEIN_ID ACD31236.1 GB:DB_XREF GI:187712939 GB:GENE:GENE sucD LENGTH 290 SQ:AASEQ MSVLVDKNTKVLVQGFTGKNGTFHSEQAIAYGTNIVGGVTPGKGGTTHLDRPVFNTMAEAVAATGADASVIYVPAPFVKDSAIEAIDSGVKLVVIITEGVPTLDMLVVKEYLKDKDVRVIGPNCPGIITPGECKIGIMPGHIHMKGKVGIISRSGTLTYEAVAQTTKLGFGQSTCIGIGGDPIPGMNQIEALKLLENDPQTEAIILIGEIGGTAEEEAAEYIKHNVTKPVIGYIAGVTAPPGKRMGHAGAIISGGKGTAEEKFAAFEAAGIAYTRSPAEIGKKLKEVTGW GT:EXON 1|1-290:0| BL:SWS:NREP 1 BL:SWS:REP 1->290|SUCD_PSEAE|e-100|71.4|290/295| PROS 236->249|PS00399|SUCCINYL_COA_LIG_2|PDOC00335| PROS 152->181|PS01216|SUCCINYL_COA_LIG_1|PDOC00335| SEG 36->47|vggvtpgkggtt| SEG 201->220|teaiiligeiggtaeeeaae| SEG 259->269|aeekfaafeaa| BL:PDB:NREP 1 BL:PDB:REP 2->287|1jkjA|1e-90|67.5|286/287| RP:PDB:NREP 1 RP:PDB:REP 2->287|1cqjA|1e-43|63.6|286/286| RP:PFM:NREP 2 RP:PFM:REP 9->99|PF02629|1e-10|45.1|91/95|CoA_binding| RP:PFM:REP 151->258|PF00549|7e-08|35.2|108/127|Ligase_CoA| HM:PFM:NREP 2 HM:PFM:REP 6->99|PF02629|7.5e-32|38.3|94/96|CoA_binding| HM:PFM:REP 151->270|PF00549|6.3e-23|35.8|120/153|Ligase_CoA| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00549|IPR005811| GO:PFM GO:0008152|"GO:metabolic process"|PF00549|IPR005811| RP:SCP:NREP 2 RP:SCP:REP 2->122|1cqiA1|5e-21|65.3|121/121|c.2.1.8| RP:SCP:REP 123->287|1cqiA2|6e-38|62.4|165/165|c.23.4.1| HM:SCP:REP 1->122|1eucA1|1e-50|53.3|122/0|c.2.1.8|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 123->289|1oi7A2|2e-62|44.3|167/0|c.23.4.1|1/1|Succinyl-CoA synthetase domains| OP:NHOMO 1275 OP:NHOMOORG 918 OP:PATTERN 111111111111111111111112111111111111111111111122-----1-------1111-11 111111-1111---11111-11111111111111111111111111111111111111--112111122111111111----122122111------11111111111111111111111111112222222222211111---11-11-111----------11--1111------------11111---1111111111111111111111111111111111------1111111111111111111111-----------------------------------------------------------------------11-------------------------1--1-33--2--111-------1-1111111111121111131111211111111111-332222221211111111211111121112111111312--------111-2111111111111111111111111111111111111111111111111111111111311111111111121111122111111121111111111111111122211111111111-11111-32314141111211121--11111111----------21221111111111111111111111111111111111111111------21111112223233322-22222332222321212231111111111111111111111111111111211111111111111111111111111121111111111-111-11111111111111111111111111111111111111111111111111111111111111111111111112-111111------------------------------------1---1-1---111 11--112-421-2222232222222222222222231111122222222233231122222221111111111111111111111112-24222222222223323-2214493223111122244-117L3-3141211211342222221141322233722222524344332121H1112251363432132223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 287 STR:RPRED 99.0 SQ:SECSTR HcccccTTcEEEEETTTcHHHHHHHHHHHHHTcEEEEEEcTTcTTEEETTEEEEccHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHTccEEEEccccccHHHHHHHHHHHHHTTcEEEcccccEEEETTTEEEEcccGGGccEEEEEEEEccHHHHHHHHHHHHHTcccEEEEEEccccccccccHHHHHHHHHTcTTccEEEEEEEccccHHHHHHHHHHHHccccEEEEEEcTTccTTcccccTTccccTTcccHHHHHHHHHHTccEEcccGGGHHHHHTTc### PSIPRED cEEccccccEEEEEcccccccHHHHHHHHHcccccEEEEcccccccEEEcccccccHHHHHccccccEEEEEccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEccccccEEcccccccccccccccccccEEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccEEcccHHHHHHHHHHHHcc //