[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : sufB
DDBJ      :sufB         sufS activator complex, sufB subunit
Swiss-Prot:             

Homologs  Archaea  63/68 : Bacteria  613/915 : Eukaryota  23/199 : Viruses  0/175   --->[See Alignment]
b.80.6
:480 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   308->460 2zu0B PDBj 6e-15 28.1 %
:RPS:PDB   38->320 2dyoA PDBj 9e-64 8.5 %
:RPS:SCOP  42->478 1vh4A  b.80.6.1 * 1e-78 18.7 %
:HMM:SCOP  32->479 1vh4A_ b.80.6.1 * 4.1e-144 47.7 %
:RPS:PFM   218->452 PF01458 * UPF0051 6e-66 54.6 %
:HMM:PFM   217->452 PF01458 * UPF0051 1.8e-66 30.7 228/230  
:BLT:SWISS 2->480 Y074_SYNY3 0.0 66.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30902.1 GT:GENE sufB GT:PRODUCT sufS activator complex, sufB subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1060229..1061671) GB:FROM 1060229 GB:TO 1061671 GB:DIRECTION - GB:GENE sufB GB:PRODUCT sufS activator complex, sufB subunit GB:PROTEIN_ID ACD30902.1 GB:DB_XREF GI:187712605 GB:GENE:GENE sufB LENGTH 480 SQ:AASEQ MSENLDKIIEQDYEHGFVTNIEAETIEAGLNEDVIRLISARKNELEFLLEWRLKAYHKWLEMKSPKWADLNYPPIDFQAISYYSSPKSLKNHPKSLDEVDPEIIETYNKLGIPLHEQKMLAGVRNIAVDAVFDSVSVVTTFKEKLAEAGVIFCPISEAVQKYPELVQKYLGSVVPQGDNFFAALNSAVFSDGSFVYIPKGVTCPMELSTYFRINAMNTGQFERTLIIADEGSYVSYLEGCTAPMRDENQLHAAVVELVALDGAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGVCHKNAKISWTQVETGSAITWKYPSVVLRGDNSIGEFYSVALTRHAQQADTGTKMIHLGKNTKSTIISKGISAGKASQAYRGLVRISPNAANARNFSQCDSLLIGHNCGAHTYPYIENKSNSSQIEHEATTSKISDDQLFYCKQRGLSEEDAIAMIVNGFCKEVFKKLPLEFAVEAQKLMEVSLEGAV GT:EXON 1|1-480:0| BL:SWS:NREP 1 BL:SWS:REP 2->480|Y074_SYNY3|0.0|66.0|476/480| SEG 127->141|avdavfdsvsvvttf| BL:PDB:NREP 1 BL:PDB:REP 308->460|2zu0B|6e-15|28.1|153/414| RP:PDB:NREP 1 RP:PDB:REP 38->320|2dyoA|9e-64|8.5|260/269| RP:PFM:NREP 1 RP:PFM:REP 218->452|PF01458|6e-66|54.6|227/230|UPF0051| HM:PFM:NREP 1 HM:PFM:REP 217->452|PF01458|1.8e-66|30.7|228/230|UPF0051| GO:PFM:NREP 2 GO:PFM GO:0005515|"GO:protein binding"|PF01458|IPR000825| GO:PFM GO:0016226|"GO:iron-sulfur cluster assembly"|PF01458|IPR000825| RP:SCP:NREP 1 RP:SCP:REP 42->478|1vh4A|1e-78|18.7|396/410|b.80.6.1| HM:SCP:REP 32->479|1vh4A_|4.1e-144|47.7|405/413|b.80.6.1|1/1|Stabilizer of iron transporter SufD| OP:NHOMO 1136 OP:NHOMOORG 699 OP:PATTERN 11212211222222211212111122232223111--1111111-11111111-11111212221-22 --21111222211111111-111111111111111111112122121112222221122212212212221122211111112-----2222222221122222222222111111111111112----------1222221112222222222211222222121122222121111111212222211-2222222222222222222222222222222222222222222222222222222222222221-21122-22222211221222222222222233322222222222222222222222232222222221--22------------22-----1-1121--1----------2211--121211112222221233221121122222222222211121121122222221111221114311111111111111111111112221-21-----------------------------211111-------------111----111111-----1---------11--22-------2----------222---212--111111111-------1--11212-111----------------------11-----122-2--2-------------------211222-------22-2-222222222222-22222222222222222222222222222212222222222121212222222222222222222112-11111111111211--------------------------2-----------------1111111111-----------1--22222222222222----112222--------211-----------1------1------111111-111222 -1-----1----------------------------------------------------------------------------------------------------1-----------------------------------------------------------------12111F111114111-22111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 416 STR:RPRED 86.7 SQ:SECSTR #####################################HHHHHHTcEEEEEEEEcGGGccTTcGGGGEEEEEEEccccGcccGGGHHHHEHHHHGGGcccccccEEEEEETTEEEcTTccHHHHTHHTTTHHHHHGGGcccccccEEEEEEEEEEEEEEEccccTTcccccccTTHHHHHHHHHHHHHHHHHHcccHHHHTccHHHHHHHHHHHHHTcHHHHHHHHHHHcccccccccEEEEccccccccEEccccccTTc##cccTGGGHHHHccTTTc#####cEEEEETTEEcTTccHHHHHHHHccTTccEEEEEEEcccccEEEEEEEEcccTTcEEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEcTTcTTcEEEEEEEEEEccTTcEEEEEEEEEEcccccEEEEEEEEEcccHHHHHHHHTTTccHHHHHHHHHHHHHHHHHTTc#################### DISOP:02AL 480-481| PSIPRED ccHHHHHHHcccccccccccccHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccHHHEEEEcccccccccccccHHccHHHHHHHHHccccHHHHHHHHHHHccccEEEEEccEEEccccHHHHHcccEEccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEccccEEcccEEEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEcccccccEEEEEEEEEEccccEEEEEEEEccccccccccccEEEEEEEEEEEccccEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEccccEEEEEEEEEEEEccccEEEEEEEEEEccccEEEEEEEEEEcccccccccEEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccc //