[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : sufC
DDBJ      :sufC         sufS activator complex, sufC subunit
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  906/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:249 amino acids
:PSIPRED
:BLT:PDB   2->247 2zu0C PDBj 3e-77 55.7 %
:RPS:PDB   2->46 2d2fA PDBj 6e-07 69.8 %
:RPS:PDB   30->227 1bifA PDBj 1e-20 7.1 %
:RPS:SCOP  1->228 1q3hA  c.37.1.12 * 4e-26 19.3 %
:HMM:SCOP  3->234 1e69A_ c.37.1.12 * 5.1e-42 34.7 %
:RPS:PFM   7->70 PF05496 * RuvB_N 7e-04 32.8 %
:HMM:PFM   44->175 PF00005 * ABC_tran 1.2e-10 27.6 116/118  
:HMM:PFM   11->59 PF03193 * DUF258 3e-07 30.4 46/161  
:BLT:SWISS 2->247 SUFC_ECOLI 8e-77 55.7 %
:PROS 149->163|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30901.1 GT:GENE sufC GT:PRODUCT sufS activator complex, sufC subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1059437..1060186) GB:FROM 1059437 GB:TO 1060186 GB:DIRECTION - GB:GENE sufC GB:PRODUCT sufS activator complex, sufC subunit GB:PROTEIN_ID ACD30901.1 GB:DB_XREF GI:187712604 GB:GENE:GENE sufC LENGTH 249 SQ:AASEQ MLLEIKDLHVSVGEQKKQILKGLNLTVKKGEVHAIMGPNGAGKSTLSNVLAGKDGYEITQGSITFDGKDLNDLSISERAAAGIFLSLQYPIEIPGVSNVQFLKTALNSIRKQNGEDEIDAISFMKKLKENMQVLKIDQKYMSRGVNEGFSGGEKKRNEMLQLMMLEPKLAILDETDSGLDIDALQVVSQGANSMRSADRSFLVITHYQRLLDHIQPDFVHVLADGKIVKTGGKELALELEEKGYSWLNS GT:EXON 1|1-249:0| BL:SWS:NREP 1 BL:SWS:REP 2->247|SUFC_ECOLI|8e-77|55.7|244/248| PROS 149->163|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 229->243|ktggkelaleleekg| BL:PDB:NREP 1 BL:PDB:REP 2->247|2zu0C|3e-77|55.7|244/247| RP:PDB:NREP 2 RP:PDB:REP 2->46|2d2fA|6e-07|69.8|43/246| RP:PDB:REP 30->227|1bifA|1e-20|7.1|169/432| RP:PFM:NREP 1 RP:PFM:REP 7->70|PF05496|7e-04|32.8|64/232|RuvB_N| HM:PFM:NREP 2 HM:PFM:REP 44->175|PF00005|1.2e-10|27.6|116/118|ABC_tran| HM:PFM:REP 11->59|PF03193|3e-07|30.4|46/161|DUF258| GO:PFM:NREP 3 GO:PFM GO:0006281|"GO:DNA repair"|PF05496|IPR008824| GO:PFM GO:0006310|"GO:DNA recombination"|PF05496|IPR008824| GO:PFM GO:0009378|"GO:four-way junction helicase activity"|PF05496|IPR008824| RP:SCP:NREP 1 RP:SCP:REP 1->228|1q3hA|4e-26|19.3|202/265|c.37.1.12| HM:SCP:REP 3->234|1e69A_|5.1e-42|34.7|222/308|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 16595 OP:NHOMOORG 1167 OP:PATTERN 87848666CDBBDCC7K4898C5GG798J6EA53678565664A868B5DXRF69AADCDB984K123 66E6L839CCCA5486555-5933AN555554CAAADIGH395KADAB9A84JNL57E66A7B6EABPHF7IAAAJFEE4LB655655AA9A2668B1178F9A7DBF4C433333344444444A989D899BD6CDDCDA98D4IDHFEDFA988568576A98ELOOA775A98765D7896A57MI68KSVVaVYXdjNeecZddbWbbVXgdlELQcTEISRQORQeiMJJILIHIHHJJJHHHHEGHULAHLJGBIELOLCDLSHFBEMLLMONOQTTOSYSTRVVRRRRTRRUGFGGEGGGHHGFGUQRLLKRPSOTZLekcdcigifNbQSRVVMOQQoKRYTELR64WXHG5CM9A4PJPTBILA9A78835C99AB7mZdC6DYRWWQXVUVXTYSTTq1BDHDBK9JVwC4*ppr*zq***yuWQ756PSdROQTYNO66666666G6745E9I2222122211--11342133131132332C53436QTMFPQPRPSPIFFFFQQZeHFGHFKPNcMOLD6CJMDLDCIKOLZRUg6G92995997777988AA9BDICKR5D7HA89L7793758659C4A7986DDDM798966666741211112114756777B6PBGDD6BAKA7776C9BA88B7B9BACB2-67477111---FGOH8LGKMMLKLMJII-LHJJKILIKILIIHHJHHHHMJUWCIDAB8AA9AAABB9A9ABMICEHIHG64PQQRQRRRQQQQ33744433599CA65QEbGEEE8H68A88A68G68A986C57DACAABAENJMIFJFH9KOO6776767679EJHNPROQQPNJOM55434343334333336FFEBAAB11121222e1G44322-675266335476A366333HFIC9JQJNL475 1---IF8-41216AC656579C8I7HBAB6968FCB5878568566AA7BB6BB9A95465632335624234432412336545424-53459668577533FH92CEPK98AFCD65535D7QJ1N3W*J-LBGA852H27EB48445C53j4E79OBO*4OAE3JAEmMUA86546*47527MLMm3TJ9EdVng4 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEEcccccEEEEccEEEEccccEEEEEccccccHHHHHHHHcccccccccccEEEEccEEcccccHHHHHHccEEEEccccccccHHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHccccccEEEEEEccEEEEEccHHHHHHccccccHHHcc //