[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : sufE
DDBJ      :sufE         sulfur acceptor protein SufE
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  339/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
d.224.1
:138 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   22->136 1ni7A PDBj 1e-18 37.4 %
:RPS:SCOP  16->134 1mzgA  d.224.1.1 * 5e-43 33.6 %
:HMM:SCOP  5->136 1mzgA_ d.224.1.1 * 3.5e-42 48.5 %
:RPS:PFM   18->127 PF02657 * SufE 7e-30 51.8 %
:HMM:PFM   13->134 PF02657 * SufE 1.3e-37 40.2 122/125  
:BLT:SWISS 18->128 YROS_RHIET 2e-22 45.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30602.1 GT:GENE sufE GT:PRODUCT sulfur acceptor protein SufE GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 672866..673282 GB:FROM 672866 GB:TO 673282 GB:DIRECTION + GB:GENE sufE GB:PRODUCT sulfur acceptor protein SufE GB:PROTEIN_ID ACD30602.1 GB:DB_XREF GI:187712305 GB:GENE:GENE sufE LENGTH 138 SQ:AASEQ MENQVVQKQQELVEELSFFEDWEDKYDYVISLAKQLPEFPEEKKTEENLVKGCQSQVWFDSNIDQGKLNFIATSDALIVSGLIGMLLRVYNNATPAEILASNTDFIKQIGFGNNLSTTRANGLKSMLDYIYATAKQNQ GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 18->128|YROS_RHIET|2e-22|45.9|111/151| TM:NTM 1 TM:REGION 70->92| SEG 2->15|enqvvqkqqelvee| BL:PDB:NREP 1 BL:PDB:REP 22->136|1ni7A|1e-18|37.4|115/149| RP:PFM:NREP 1 RP:PFM:REP 18->127|PF02657|7e-30|51.8|110/125|SufE| HM:PFM:NREP 1 HM:PFM:REP 13->134|PF02657|1.3e-37|40.2|122/125|SufE| RP:SCP:NREP 1 RP:SCP:REP 16->134|1mzgA|5e-43|33.6|119/144|d.224.1.1| HM:SCP:REP 5->136|1mzgA_|3.5e-42|48.5|132/144|d.224.1.1|1/1|SufE/NifU| OP:NHOMO 452 OP:NHOMOORG 354 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------111111111--11111111111-------111----1---------------------111111111--111111111-1111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111221111111111111111111-1111111111111111111111112111111111111111111111111111--1------------------------------11111-----------------------------------------------------------------------1-------------------------------1----------------------11--1111111211111111111111111111111---11-------22111222222222222-22222222222222222222222222222222222221222222222222221222222222222111-----------1112----11--11--111-----------11111-1-1-----111111111111111111111111121111111111111111----111111-----------------------------------------------11 -1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111B--1114--2-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 84.1 SQ:SECSTR ####################cHHHHHHHHHHHHHHcccccHHHHHHcEEEccccccEEEEccccccccccEEEEccHHHHHHHHHHHHHTTTccHHHHHHcTHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHH## PSIPRED ccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHcHHHccccccccEEEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHHHcc //