[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : tmk
DDBJ      :tmk          thymidylate kinase
Swiss-Prot:KTHY_FRATM   RecName: Full=Thymidylate kinase;         EC=2.7.4.9;AltName: Full=dTMP kinase;

Homologs  Archaea  49/68 : Bacteria  795/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:209 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->193 4tmkA PDBj 2e-41 45.8 %
:RPS:PDB   2->186 1e2mA PDBj 2e-14 14.2 %
:RPS:SCOP  2->203 1e2dA  c.37.1.1 * 1e-45 28.6 %
:HMM:SCOP  1->209 1e2kA_ c.37.1.1 * 7.2e-56 40.0 %
:RPS:PFM   9->195 PF02223 * Thymidylate_kin 2e-39 42.2 %
:HMM:PFM   8->197 PF02223 * Thymidylate_kin 2.9e-54 41.6 185/186  
:BLT:SWISS 1->209 KTHY_FRATM e-118 100.0 %
:PROS 94->106|PS01331|THYMIDYLATE_KINASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30267.1 GT:GENE tmk GT:PRODUCT thymidylate kinase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 198785..199414 GB:FROM 198785 GB:TO 199414 GB:DIRECTION + GB:GENE tmk GB:PRODUCT thymidylate kinase GB:PROTEIN_ID ACD30267.1 GB:DB_XREF GI:187711970 GB:GENE:GENE tmk LENGTH 209 SQ:AASEQ MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFNFQN GT:EXON 1|1-209:0| SW:ID KTHY_FRATM SW:DE RecName: Full=Thymidylate kinase; EC=2.7.4.9;AltName: Full=dTMP kinase; SW:GN Name=tmk; OrderedLocusNames=FTM_0179; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide biosynthesis;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->209|KTHY_FRATM|e-118|100.0|209/209| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009165|"GO:nucleotide biosynthetic process"|Nucleotide biosynthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 94->106|PS01331|THYMIDYLATE_KINASE|PDOC01034| BL:PDB:NREP 1 BL:PDB:REP 2->193|4tmkA|2e-41|45.8|192/210| RP:PDB:NREP 1 RP:PDB:REP 2->186|1e2mA|2e-14|14.2|183/305| RP:PFM:NREP 1 RP:PFM:REP 9->195|PF02223|2e-39|42.2|185/188|Thymidylate_kin| HM:PFM:NREP 1 HM:PFM:REP 8->197|PF02223|2.9e-54|41.6|185/186|Thymidylate_kin| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02223|IPR000062| RP:SCP:NREP 1 RP:SCP:REP 2->203|1e2dA|1e-45|28.6|192/209|c.37.1.1| HM:SCP:REP 1->209|1e2kA_|7.2e-56|40.0|205/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 908 OP:NHOMOORG 870 OP:PATTERN --1-1---111111221111111111111111-1-1111---11-1-111111-1111111--11--- 11111-----------------------------------111111111111111111111111---111111111111111111111--------------------1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1----------1---1------111--11--1111111111111--111111111112111111111111111111111111-11112111111111111111111111111111111111111111111111111-11111111111111111113111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111311----21111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111------------11111111-1----------15D421-111111111111111111111-1111111111 1----1--------111111-----1-1111-----------------1-------------------------------------1-----1-----------1------22--1---------------------------------------1--------13----------1-----------1-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 98.6 SQ:SECSTR GEEEEEEEcccccccHHHHHHcccccEEEEcccHHHHHTTccccHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHGGGEEEEEEccccEEEEccTHHHHTHHHHTTcccHHHHHHHHHTcccccTTcEEEEEEccHHHHHHHHHTTccTcTTccccHHHHHHHHHHHHHHHHHTTccHHHHGccccTTccHHHHHHHHHHHH### PSIPRED ccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHcccccHHHHccHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHccccc //