[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : trkA
DDBJ      :trkA         trk system potassium uptake protein TrkA
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  344/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.286.1
:457 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->131 1lssA PDBj 1e-11 33.1 %
:BLT:PDB   230->347 1lssA PDBj 1e-18 39.7 %
:RPS:PDB   2->223 2aemA PDBj 2e-12 16.1 %
:RPS:PDB   275->450 2bknA PDBj 4e-10 11.2 %
:RPS:SCOP  5->131 1id1A  c.2.1.9 * 8e-12 16.7 %
:RPS:SCOP  142->223 1vctA2  d.286.1.1 * 5e-06 18.3 %
:RPS:SCOP  232->347 1id1A  c.2.1.9 * 2e-11 21.5 %
:RPS:SCOP  368->450 1vctA2  d.286.1.1 * 5e-07 24.1 %
:HMM:SCOP  1->147 1id1A_ c.2.1.9 * 1.7e-26 30.8 %
:HMM:SCOP  129->222 2fy8A2 d.286.1.1 * 7.6e-06 20.5 %
:HMM:SCOP  228->373 1id1A_ c.2.1.9 * 8.6e-22 26.2 %
:HMM:SCOP  362->448 1vctA2 d.286.1.1 * 7.8e-06 21.4 %
:RPS:PFM   3->103 PF02254 * TrkA_N 1e-14 41.0 %
:RPS:PFM   230->336 PF02254 * TrkA_N 6e-07 27.3 %
:HMM:PFM   3->105 PF02254 * TrkA_N 7.2e-25 32.4 102/116  
:HMM:PFM   230->346 PF02254 * TrkA_N 2.8e-17 28.3 113/116  
:HMM:PFM   150->205 PF02080 * TrkA_C 3.6e-06 32.1 53/71  
:HMM:PFM   388->449 PF02080 * TrkA_C 3.2e-06 22.0 59/71  
:BLT:SWISS 1->456 TRKA_VIBAL 2e-63 30.3 %
:REPEAT 2|2->221|229->450

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30904.1 GT:GENE trkA GT:PRODUCT trk system potassium uptake protein TrkA GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1062241..1063614 GB:FROM 1062241 GB:TO 1063614 GB:DIRECTION + GB:GENE trkA GB:PRODUCT trk system potassium uptake protein TrkA GB:PROTEIN_ID ACD30904.1 GB:DB_XREF GI:187712607 GB:GENE:GENE trkA LENGTH 457 SQ:AASEQ MRIAILGAGQLGVYLTQRLSLDHQVSVIDLDEEKLGFISSAFDVQTIIGDVTKPNIMMEANFKDTDMIIAVTSNDTTNIAVCDMAYKLYKTPYKIARIRDTEYNRFPKLLNNIDLVIKSFFETTKRLEQLIFLSGAYFISSFFDKRVQIVGVEVSSDSPLVGLAVKDIYLGLGDIKVDIISVYRGNEKLDIDDINVLVKPEDRVMYLSEKAYSSQILSIFQPKKTNIRKIFIAGINYASITLAKSLESKGYIIKMIDPSAEKCEFALSELSKSTILHYNPVNNNLLVAEGIDEADMFFALTNSDEINIMSSILAKKLGAKKTVATVNSSEYYDITRDLKLIDISISPHNFSYTTIKAFLTQVDMLRMYEIEDSEEMLVELKVHGQENMSTVIGKKINDLKLPQGLEIIAIMKIDNIPRFYADSFLIQDQDRLIIKVDNKNALQTLEKLFQVMPLYIA GT:EXON 1|1-457:0| BL:SWS:NREP 1 BL:SWS:REP 1->456|TRKA_VIBAL|2e-63|30.3|452/458| NREPEAT 1 REPEAT 2|2->221|229->450| BL:PDB:NREP 2 BL:PDB:REP 1->131|1lssA|1e-11|33.1|128/132| BL:PDB:REP 230->347|1lssA|1e-18|39.7|116/132| RP:PDB:NREP 2 RP:PDB:REP 2->223|2aemA|2e-12|16.1|217/226| RP:PDB:REP 275->450|2bknA|4e-10|11.2|162/190| RP:PFM:NREP 2 RP:PFM:REP 3->103|PF02254|1e-14|41.0|100/116|TrkA_N| RP:PFM:REP 230->336|PF02254|6e-07|27.3|103/116|TrkA_N| HM:PFM:NREP 4 HM:PFM:REP 3->105|PF02254|7.2e-25|32.4|102/116|TrkA_N| HM:PFM:REP 230->346|PF02254|2.8e-17|28.3|113/116|TrkA_N| HM:PFM:REP 150->205|PF02080|3.6e-06|32.1|53/71|TrkA_C| HM:PFM:REP 388->449|PF02080|3.2e-06|22.0|59/71|TrkA_C| GO:PFM:NREP 2 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02254|IPR003148| GO:PFM GO:0006813|"GO:potassium ion transport"|PF02254|IPR003148| RP:SCP:NREP 4 RP:SCP:REP 5->131|1id1A|8e-12|16.7|126/153|c.2.1.9| RP:SCP:REP 142->223|1vctA2|5e-06|18.3|81/94|d.286.1.1| RP:SCP:REP 232->347|1id1A|2e-11|21.5|113/153|c.2.1.9| RP:SCP:REP 368->450|1vctA2|5e-07|24.1|79/94|d.286.1.1| HM:SCP:REP 1->147|1id1A_|1.7e-26|30.8|146/0|c.2.1.9|1/2|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 129->222|2fy8A2|7.6e-06|20.5|88/0|d.286.1.1|1/2|TrkA C-terminal domain-like| HM:SCP:REP 228->373|1id1A_|8.6e-22|26.2|145/0|c.2.1.9|2/2|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 362->448|1vctA2|7.8e-06|21.4|84/0|d.286.1.1|2/2|TrkA C-terminal domain-like| OP:NHOMO 397 OP:NHOMOORG 381 OP:PATTERN 11-11------------------11-11211111111-111111---211222111-1111------- ---1--------------------1------1----------1-11-----------------------------------11--1--1111-111-------11---1---------------------1----1---1-222-1--1-------------------------------------11-------------------------------------------------------------------------------------------111----12211111111111-------------1--111----111--11-1111-1-2--------111--11-111-1-123-2---2-11-11----11111-------------111111111-1---------1-1--11-------11111111111111111-------------111-----------------------------1-----11111---------------------------------1-1111-------11----1111111111-11--1111111--1---1-----------1---1-----------------------111--111111111111111111111111111111---11-1------11111111111111111-11-11111111111111111111111111111111111111111111111111111111111111--11---------11111111111111111111----------1111111111111111111111111111111111111111111--------------111---------------11---------------------------1-1--1------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 449 STR:RPRED 98.2 SQ:SECSTR ccEEEEcccHHHHHHHHHTTccEEEEEccGGGHHHHHHHHTTTcEEEEccTTcHHHHHHTTcTTccEEEEccccHHHHHHHHHHHHHHcccccEEEEcccGGGHHHHHHTccEEEcHHHHHHHHHTTccccHHHHHHHHHHTcccccEEEEEEccTTcTTTTccHHHHHHcHHHHHcEEEEEEETTEEEccccTTccccTTcEEEEEEcHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHcTTcEEEEEEccGGGHHHHHHTTcEEEEccTTcHHHHHHEEEccEEEccccEEEEcccTTHHHHHHHHHHHTTccEEEEEEccHHHHHHHHHTTHccEEEEHHHHHHHHHHHHHHHHHccccccccHHHHcccEEEEEEccTTcTTTTccHHHHcHHHccEEEEEEETTEEEEcccTTccccTTcEEEE#EEcHHHHHHHHHHHc####### DISOP:02AL 456-458| PSIPRED cEEEEEcccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHcccEEEEcccccHHHHHHccHHHccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccEEEcHHHHHHHHHHHHHccccHHHHHcccccEEEEEEEEEccccccccccHHHHHcccccccEEEEEEEEcccEEEcccccEEEccccEEEEEEEHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEcccccHHHHHHccHHHccEEEEEcccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEcHHHHHHHHHHHHHcccccEEEEEEccccEEEEEEEEEccccccccccccHHHcccccccEEEEEEEcccEEEcccccEEEccccEEEEEEccHHHHHHHHHHHcccHHHcc //