[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : trpA
DDBJ      :trpA         tryptophan synthase, alpha subunit
Swiss-Prot:TRPA_FRATM   RecName: Full=Tryptophan synthase alpha chain;         EC=4.2.1.20;

Homologs  Archaea  38/68 : Bacteria  733/915 : Eukaryota  118/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->267 1tjpA PDBj 2e-78 58.0 %
:RPS:PDB   4->267 3cepA PDBj 6e-42 54.2 %
:RPS:SCOP  17->265 1geqA  c.1.2.4 * 7e-39 36.3 %
:HMM:SCOP  2->268 1xcfA_ c.1.2.4 * 6.4e-90 44.9 %
:RPS:PFM   9->256 PF00290 * Trp_syntA 5e-58 44.5 %
:HMM:PFM   9->267 PF00290 * Trp_syntA 9.8e-99 43.8 258/259  
:BLT:SWISS 1->269 TRPA_FRATM e-143 100.0 %
:PROS 49->62|PS00167|TRP_SYNTHASE_ALPHA
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30167.1 GT:GENE trpA GT:PRODUCT tryptophan synthase, alpha subunit GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 63043..63852 GB:FROM 63043 GB:TO 63852 GB:DIRECTION + GB:GENE trpA GB:PRODUCT tryptophan synthase, alpha subunit GB:PROTEIN_ID ACD30167.1 GB:DB_XREF GI:187711870 GB:GENE:GENE trpA LENGTH 269 SQ:AASEQ MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEILDTLVSSGADALELGIPFSDPLADGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCLDAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSRVGVTGTETAANMPVEDVLAKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVKIIQNNISNKQKMLNELTYFVKEMKAATLN GT:EXON 1|1-269:0| SW:ID TRPA_FRATM SW:DE RecName: Full=Tryptophan synthase alpha chain; EC=4.2.1.20; SW:GN Name=trpA; OrderedLocusNames=FTM_0058; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Lyase; Tryptophan biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->269|TRPA_FRATM|e-143|100.0|269/269| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0000162|"GO:tryptophan biosynthetic process"|Tryptophan biosynthesis| PROS 49->62|PS00167|TRP_SYNTHASE_ALPHA|PDOC00151| SEG 224->237|aikagaagaisgsa| BL:PDB:NREP 1 BL:PDB:REP 4->267|1tjpA|2e-78|58.0|264/267| RP:PDB:NREP 1 RP:PDB:REP 4->267|3cepA|6e-42|54.2|264/266| RP:PFM:NREP 1 RP:PFM:REP 9->256|PF00290|5e-58|44.5|247/255|Trp_syntA| HM:PFM:NREP 1 HM:PFM:REP 9->267|PF00290|9.8e-99|43.8|258/259|Trp_syntA| GO:PFM:NREP 2 GO:PFM GO:0004834|"GO:tryptophan synthase activity"|PF00290|IPR002028| GO:PFM GO:0006568|"GO:tryptophan metabolic process"|PF00290|IPR002028| RP:SCP:NREP 1 RP:SCP:REP 17->265|1geqA|7e-39|36.3|237/241|c.1.2.4| HM:SCP:REP 2->268|1xcfA_|6.4e-90|44.9|267/0|c.1.2.4|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 933 OP:NHOMOORG 889 OP:PATTERN -------1-------1-------111111111111111111111111111111111--1-------11 1111111111111111111-1111111111111111111112111-1-1111111111--111-11111111111111----111111111111---111-111111111-1111-1-11-----11111111111111111111111211112111111111111112211111111111111111111-11111111111-111111111111111111111111111111-1111111111111111111----11-----11--11----1-111-------21111111111111-------------1--111----11-11----------1-11----1-1--11111111111--1111111-11111111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------111111111111111111111111111111-1111111111111111111111111111111111111111111111-1111111111--11111111111111111111111111111-1111111111111111111111111111111111111111111111---111111-11111111111111111111-1111111111111112111111111111111111111111111111111111-11111111111111-1111-1111111212111111-11111-111111111111111111111111111111111111111111111111111111111111111111111111-111111--------------------------------------1--1-111111 ------1-----11111111122343311111111112111111-11111111111111211111111-1111111111111111111-11111111111-21112-11-------------------------------------------------1--------------1-11118111111442122112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 99.3 SQ:SECSTR cHHHHHHHHHHHHHTTccEEEEEEETTcccHHHHHHHHHHHHHTTcccEEEEccccccTTccHHHHHHHHHHHHTTccHHHHHHHHHHHHHHcccccEEEEEcHHHHHTTcHHHHHHHHHHHTccEEEETTccGGGcHHHHHHHHHTTcEEEcEEcTTccHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHTTcccEEEEcccccHHHHHHHHHTTccEEEEcHHHHHHHHHTTTcHHHHHHHHHHHHHHHHHTT## DISOP:02AL 269-270| PSIPRED ccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHccccEEEEHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //