[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : trpS
DDBJ      :trpS         tryptophanyl-tRNA synthetase
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  910/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:334 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->334 2el7B PDBj 3e-54 39.5 %
:RPS:PDB   4->315 2akeA PDBj 2e-50 16.4 %
:RPS:SCOP  4->334 1d2rA  c.26.1.1 * 2e-34 32.5 %
:HMM:SCOP  4->336 1d2rA_ c.26.1.1 * 4.9e-84 37.2 %
:RPS:PFM   6->287 PF00579 * tRNA-synt_1b 7e-40 40.0 %
:HMM:PFM   5->289 PF00579 * tRNA-synt_1b 1.1e-62 37.0 270/292  
:HMM:PFM   283->326 PF09062 * Endonuc_subdom 0.0004 34.1 44/98  
:BLT:SWISS 6->334 SYW_PSEAE 7e-97 52.6 %
:PROS 12->21|PS00178|AA_TRNA_LIGASE_I

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30441.1 GT:GENE trpS GT:PRODUCT tryptophanyl-tRNA synthetase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(456277..457281) GB:FROM 456277 GB:TO 457281 GB:DIRECTION - GB:GENE trpS GB:PRODUCT tryptophanyl-tRNA synthetase GB:PROTEIN_ID ACD30441.1 GB:DB_XREF GI:187712144 GB:GENE:GENE trpS LENGTH 334 SQ:AASEQ MSQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQYIYEIAASWLALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPVLMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYDNTIAIFSMEKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQILFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 6->334|SYW_PSEAE|7e-97|52.6|327/448| PROS 12->21|PS00178|AA_TRNA_LIGASE_I|PDOC00161| BL:PDB:NREP 1 BL:PDB:REP 4->334|2el7B|3e-54|39.5|306/316| RP:PDB:NREP 1 RP:PDB:REP 4->315|2akeA|2e-50|16.4|293/373| RP:PFM:NREP 1 RP:PFM:REP 6->287|PF00579|7e-40|40.0|265/279|tRNA-synt_1b| HM:PFM:NREP 2 HM:PFM:REP 5->289|PF00579|1.1e-62|37.0|270/292|tRNA-synt_1b| HM:PFM:REP 283->326|PF09062|0.0004|34.1|44/98|Endonuc_subdom| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00579|IPR002305| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00579|IPR002305| GO:PFM GO:0005524|"GO:ATP binding"|PF00579|IPR002305| GO:PFM GO:0005737|"GO:cytoplasm"|PF00579|IPR002305| GO:PFM GO:0006412|"GO:translation"|PF00579|IPR002305| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00579|IPR002305| RP:SCP:NREP 1 RP:SCP:REP 4->334|1d2rA|2e-34|32.5|317/326|c.26.1.1| HM:SCP:REP 4->336|1d2rA_|4.9e-84|37.2|317/0|c.26.1.1|1/1|Nucleotidylyl transferase| OP:NHOMO 1259 OP:NHOMOORG 1109 OP:PATTERN 11111--1-------11---1-1----------1-11-11111------------1-1--11---1-1 1111211111111111111-11111111111111111111112112111111111112112121212222112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112221111112122222122222222222111121211111111111111211111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111211111111111111111111111111111111111-11112111112121111111111111111111111111111111111111111111111111111211111111111111111111111111111222122222221121222212222111111111111111111111111111221111111111111111111111111111111111112111111111111111111111111111111111112211111111111111111111111111111-1111111111121112211111111111-11111111111111111112221111221222222222222222111111111111111111111111111111111111211111111111111111111111111111111111112111121111111111111211211111222111111111111111111111111111111111111111111-11111111111111111111111111111111 1---111-1---1111111-1-1-111111111111-11111111111111-1111111111111111111111111--111111111-1111111---1111111--2121-1112111111121111292-112111111111111111111-121112511111111512221111I111-111211311121112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 334 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHTccEEEEEcHHHHHHccccHHHHHHHHHHHHHHHHTTTccTTcEEEEEHHHHHHHTTccHHHHHHHHHHHTccHHHHHHHHccccccHHTTccTTccHHHHTHHHHHHGGGcGGGcHEEEEEGGGHHHHHHHHHHHHHTTccccEEEEcccEEEEEcccccTTcccccccTTcGGGcccTTccHHHHHHHHHHHcccccccHHHHHcccTTTcHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHTcccccccHHHHHHHHHHHHHHHHHTc PSIPRED ccccEEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHccccccccHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //