[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : ubiH
DDBJ      :ubiH         2-octaprenyl-6-methoxyphenyl hydroxylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  457/915 : Eukaryota  102/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:403 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->45 2ywlA PDBj 2e-04 41.5 %
:BLT:PDB   44->305 3fmwA PDBj 2e-06 22.7 %
:RPS:PDB   6->347 3c96A PDBj 8e-34 15.5 %
:RPS:SCOP  1->177 1ng3A1  c.3.1.2 * 2e-08 14.6 %
:RPS:SCOP  152->336 3c96A1  c.3.1.2 * 5e-24 12.1 %
:HMM:SCOP  3->396 1k0iA1 c.3.1.2 * 1.7e-49 28.1 %
:RPS:PFM   6->305 PF01494 * FAD_binding_3 3e-30 33.0 %
:RPS:PFM   281->336 PF08491 * SE 1e-04 35.7 %
:HMM:PFM   5->311 PF01494 * FAD_binding_3 8.6e-35 21.7 304/356  
:HMM:PFM   270->384 PF08491 * SE 1.8e-10 22.6 115/276  
:BLT:SWISS 6->55 MNMC_HAES2 8e-05 38.0 %
:BLT:SWISS 43->390 UBIH_ECOLI 8e-40 28.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD30703.1 GT:GENE ubiH GT:PRODUCT 2-octaprenyl-6-methoxyphenyl hydroxylase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 789951..791162 GB:FROM 789951 GB:TO 791162 GB:DIRECTION + GB:GENE ubiH GB:PRODUCT 2-octaprenyl-6-methoxyphenyl hydroxylase GB:PROTEIN_ID ACD30703.1 GB:DB_XREF GI:187712406 GB:GENE:GENE ubiH LENGTH 403 SQ:AASEQ MNAKYDVAIVGGGIVGLFTSLALAKTGCKIIHIEKDRLQVKNDNRSIAVSYSSIAFLNTLGLWDKVASKTQAIKKVHVSDKGRYGRAEIFAKDENLPFLGAIAPMQELLTVALQSVAANPNIIKSFETNVIDLAKHDDKYSLVVKQQEQTKTIRAQLIIACDGANSSLRKMLNITAKTTDYQQDALVFDIQTELDNNNTAFERFMTDGVLAMLPKVKTTMGCVWTIDRDNSKAKLTLDNKEFEQLVQDRFGYRLGQIKLTSKPAVFPLYLVQAEQVYKNNVLFFGNALHFLHPVSGQGMNLSIRDIGFLYDLLVESDFSQNSITAVLAEFAKVRKPDHDRTIFVTHGFVKWFVSNNTKFVASRNAGLHLLQRSKLAKKVLSRVMMGKLSKGSTLMRKVVEDER GT:EXON 1|1-403:0| BL:SWS:NREP 2 BL:SWS:REP 6->55|MNMC_HAES2|8e-05|38.0|50/676| BL:SWS:REP 43->390|UBIH_ECOLI|8e-40|28.1|345/392| TM:NTM 2 TM:REGION 3->25| TM:REGION 46->68| BL:PDB:NREP 2 BL:PDB:REP 5->45|2ywlA|2e-04|41.5|41/178| BL:PDB:REP 44->305|3fmwA|2e-06|22.7|242/482| RP:PDB:NREP 1 RP:PDB:REP 6->347|3c96A|8e-34|15.5|336/381| RP:PFM:NREP 2 RP:PFM:REP 6->305|PF01494|3e-30|33.0|294/338|FAD_binding_3| RP:PFM:REP 281->336|PF08491|1e-04|35.7|56/272|SE| HM:PFM:NREP 2 HM:PFM:REP 5->311|PF01494|8.6e-35|21.7|304/356|FAD_binding_3| HM:PFM:REP 270->384|PF08491|1.8e-10|22.6|115/276|SE| GO:PFM:NREP 6 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF01494|IPR002938| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01494|IPR002938| GO:PFM GO:0004506|"GO:squalene monooxygenase activity"|PF08491|IPR013698| GO:PFM GO:0016021|"GO:integral to membrane"|PF08491|IPR013698| GO:PFM GO:0050660|"GO:FAD binding"|PF08491|IPR013698| GO:PFM GO:0055114|"GO:oxidation reduction"|PF08491|IPR013698| RP:SCP:NREP 2 RP:SCP:REP 1->177|1ng3A1|2e-08|14.6|171/276|c.3.1.2| RP:SCP:REP 152->336|3c96A1|5e-24|12.1|174/269|c.3.1.2| HM:SCP:REP 3->396|1k0iA1|1.7e-49|28.1|288/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 1112 OP:NHOMOORG 559 OP:PATTERN -------------------------------------------------------------------- --1--------------11-11--2-11111----------------------1--------------------------------------------------------------------------------------------1-211111211-11111111-111-1-11111111111-----------------2-----1---------------11-------------------------------------------------------------------------------------------------------------------------------------------------------1111222221-3343232323222222222222-222222212211222222222222231112222222222222222221222112111111111111111111111111111111111311322223222232222222222222232222323223222-1221111312222332321111111222222----------------------------1----------------------------22333332332333333333333333333333--12332------33333334443433333-43434343444344434433233334333333333333333334333333432333333333333223222222222221331333-1-2----3333222222222221222223223222222222222222222333333333333333323233222222222--------------------------------------------------------- ----11--211-1111-11122-----11--------1-1--1---1111111111---1111-1-------1-1----------1--------1-----1--------12--111-11--111311313A2-413-1--1-1211111111111111----1211-112-1111--1----1111111-111--1-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 396 STR:RPRED 98.3 SQ:SECSTR cccccEEEEEcccHHHHHHHHHHHTTccEEEEEEcccccccccccEEEEcHHHHHHHHHTTcHHHHHHHcEEEcEEEEEcTccEEEEEEcGGGGTccccEEEEEHHHHHHHHHHHHHHHcTTcEEEcEEEEEEEEETTEEEEEEEETccEEEEEEcEEEEcccTTcHHHHHHcTTccccEEEEEEEEEEEEEEcccTTccEEEEEEcTTccEEEEEEccHHEEEHHHHccccccccTTccccHHHHHHHHTTcccTTcccEEEEEEEEEcccccccccTTEEEcTHHHHcccccTTcTHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHTcHHHHHHHHHHHcccccTTcTTTc####### PSIPRED ccccccEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccccEEEEcHHHHHHHHHcccHHHHHHccccEEEEEEcccccccEEEcccccccccccEEEEEHHHHHHHHHHHHHHccccEEEEccEEEEEEEcccEEEEEEEEccccEEEEEEEEEEcccccHHHHHHcccccccccccEEEEEEEEEcccccccEEEEEEccccEEEEEEccccEEEEEEEEcccccHHHccccHHHHHHHHHHHHHHHHcccEEccccEEEEcccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHccccccccc //