[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : udhA
DDBJ      :udhA         soluble pyridine nucleotide transhydrogenase (STH)(NAD(P)(+) transhydrogenase [B-specific])
Swiss-Prot:             

Homologs  Archaea  44/68 : Bacteria  865/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.87.1
:466 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->453 1dxlA PDBj 9e-45 30.4 %
:RPS:PDB   3->453 1dxlA PDBj 6e-59 29.3 %
:RPS:SCOP  5->143 1aogA1  c.3.1.5 * 2e-08 16.8 %
:RPS:SCOP  118->322 1gv4A1  c.3.1.5 * 3e-21 11.4 %
:RPS:SCOP  335->457 1aogA3  d.87.1.1 * 2e-27 22.5 %
:HMM:SCOP  1->309 1d5tA1 c.3.1.3 * 1e-50 31.1 %
:HMM:SCOP  332->461 1fecA3 d.87.1.1 * 2.1e-27 29.9 %
:RPS:PFM   19->301 PF07992 * Pyr_redox_2 6e-15 29.3 %
:RPS:PFM   335->442 PF02852 * Pyr_redox_dim 4e-13 39.4 %
:HMM:PFM   6->304 PF07992 * Pyr_redox_2 9.5e-39 35.2 196/202  
:HMM:PFM   335->444 PF02852 * Pyr_redox_dim 1.2e-30 31.8 107/110  
:BLT:SWISS 3->454 STHA_ECOSM e-128 53.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31055.1 GT:GENE udhA GT:PRODUCT soluble pyridine nucleotide transhydrogenase (STH)(NAD(P)(+) transhydrogenase [B-specific]) GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION 1260196..1261596 GB:FROM 1260196 GB:TO 1261596 GB:DIRECTION + GB:GENE udhA GB:PRODUCT soluble pyridine nucleotide transhydrogenase (STH)(NAD(P)(+) transhydrogenase [B-specific]) GB:PROTEIN_ID ACD31055.1 GB:DB_XREF GI:187712758 GB:GENE:GENE udhA LENGTH 466 SQ:AASEQ MEYNYDIIIIGSGPGGEGAAMKATRNGQKVAIIEDDAIGGGCNNWGTIPSKALRQLSREVWYNKKNFDFPEMLDTAYEIVIKQREIKRNRFANNEIDVFYGFASFIDKHKIKISRKNGSTEIITAKKFILSTGSRPYHPDDIDFTHPRILDSDKLLELKDKNIKSITIYGAGVIGCEYASILGTLDIQVNLINTRNKLMSFLDDEIIETLTNHFTVNQRINLIHNETYKSIKARGDKVVTTLNSGRIIESDYVLFALGRSGNTNGLNLDKIGVEYDPQRGLVKVNDNYQTTQENIYAVGDVIGFPSLASSAFNQGRFAATHIIDGSCNDKLVEDIPTGIYTRPEISCIGKTEEQLTAENIPYEVGRAYFKDLARAQISGSETGMLKILFHKETLEILGIHCFGHRVSEIIHIGQAIKSMPGKHNTIRYFLNTTFNYPTMAEAYRIAGIDGLNKLKPKNKQFVPEHQ GT:EXON 1|1-466:0| BL:SWS:NREP 1 BL:SWS:REP 3->454|STHA_ECOSM|e-128|53.5|449/466| SEG 7->18|iiiigsgpggeg| SEG 150->161|ldsdkllelkdk| BL:PDB:NREP 1 BL:PDB:REP 22->453|1dxlA|9e-45|30.4|425/467| RP:PDB:NREP 1 RP:PDB:REP 3->453|1dxlA|6e-59|29.3|443/467| RP:PFM:NREP 2 RP:PFM:REP 19->301|PF07992|6e-15|29.3|256/275|Pyr_redox_2| RP:PFM:REP 335->442|PF02852|4e-13|39.4|104/110|Pyr_redox_dim| HM:PFM:NREP 2 HM:PFM:REP 6->304|PF07992|9.5e-39|35.2|196/202|Pyr_redox_2| HM:PFM:REP 335->444|PF02852|1.2e-30|31.8|107/110|Pyr_redox_dim| GO:PFM:NREP 5 GO:PFM GO:0005737|"GO:cytoplasm"|PF02852|IPR004099| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02852|IPR004099| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF02852|IPR004099| GO:PFM GO:0050660|"GO:FAD binding"|PF02852|IPR004099| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02852|IPR004099| RP:SCP:NREP 3 RP:SCP:REP 5->143|1aogA1|2e-08|16.8|139/238|c.3.1.5| RP:SCP:REP 118->322|1gv4A1|3e-21|11.4|201/224|c.3.1.5| RP:SCP:REP 335->457|1aogA3|2e-27|22.5|120/130|d.87.1.1| HM:SCP:REP 1->309|1d5tA1|1e-50|31.1|305/0|c.3.1.3|1/1|FAD/NAD(P)-binding domain| HM:SCP:REP 332->461|1fecA3|2.1e-27|29.9|127/128|d.87.1.1|1/1|FAD/NAD-linked reductases, dimerisation (C-terminal) domain| OP:NHOMO 3825 OP:NHOMOORG 1103 OP:PATTERN 221-114245566565121----13111-25112-1------122121113321-------344---- 4444532344533374544-66--744444425444277534342435444245934333337354432221111222--113131114442-42212222227333232111111111111113131222112122111211121444344412332222232224547422222222222232233111153555555453556545453343555242426654444455333333333333333385644221541222266332335465246553333334433333323333322222222222224443334443224-244444443521433112232--12-1--42-31123113222122215533333333356343343333344444444445-33535534674345546586667736545554343356533333333433243432232222222112222222222222222215357245457677768644446635555534566474822344343453254523543111233333333463422235223323333321324234351333344-2111-------------------212553437754534722222252422322223341-1764411111143334334445455544-4444455444454343444444333334444454444364445433333343145555555555511331111144542475522222222222222254445345543356675555455564433544445344244454444453444433433422222222222443333--------1-221211-2-42111222131122---1121111111541 3411225-C35-2222222122223222222222212222222221323334382223222222222222222233323422222222-53222222222222425-34573C244652545549A1D2L*9-A5I2223933654453351594876659F24421533635654454*44455655A2848988677 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 466 STR:RPRED 100.0 SQ:SECSTR cEccccEEEEcccHHHHHHHHHHHHHTccEEEEEcccccccHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHTcEEEEccEEEEETTEEEEcccccccEEEEccEEEEcccEEEcccTTcccccccEEcHHHHTTcccccccEEEEccccHHHHHHHHHHHHHTcEEEEEcccccccTTccHHHHHHHHHHHHHHccccEEccEEEEEEEcccccEEEEEcccEEEEEcEEEccccEEEccTTcccTTTTcccccTcccccccTTcccccTTEEEccTTccccccHHHHHHHHHHHHHHHHTTccccccTTcccEEEccccEEEEEEccHHHHHHTTccEEEEEEEGGGcHHHHHHcccccEEEEEEETTTccEEEEEEEETTHHHHHHHHHHHHHTccTTccHHHHHTcccccccTTHHHHHHHHHHHcccccccccTTTEEE DISOP:02AL 466-467| PSIPRED ccccEEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccEEEEEccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccEEEEEEccccEEEEEEcEEEEccccEEccccccccccccEEEHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEccccEEEEcEEEEEccEEEcccccccHHccEEEccccccEEEccEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEccccEEEEEccHHHHHHccccEEEEEEEEcccccccccccccEEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHHHHHcccccccHHHccccc //