[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : udk
DDBJ      :udk          uridine kinase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  384/915 : Eukaryota  176/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   27->213 1ufqB PDBj 2e-33 35.9 %
:RPS:PDB   34->216 1a7jA PDBj 2e-24 15.9 %
:RPS:SCOP  21->169 1odfA  c.37.1.6 * 5e-25 22.1 %
:HMM:SCOP  8->205 1esmA_ c.37.1.6 * 4e-44 29.2 %
:RPS:PFM   21->193 PF00485 * PRK 3e-30 41.8 %
:HMM:PFM   9->200 PF00485 * PRK 3.3e-43 27.5 189/194  
:BLT:SWISS 24->215 URK_STAHJ 1e-46 49.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31218.1 GT:GENE udk GT:PRODUCT uridine kinase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1485685..1486350) GB:FROM 1485685 GB:TO 1486350 GB:DIRECTION - GB:GENE udk GB:PRODUCT uridine kinase GB:PROTEIN_ID ACD31218.1 GB:DB_XREF GI:187712921 GB:GENE:GENE udk LENGTH 221 SQ:AASEQ MAGKGDVFIIGIVGGSGSGKTLFSNAIIKKLKSKHLNKIAVISEDRYYKNWGEMVGFEEACKINYDHPDAFDHKLLRKDLNNLVQGNDIYIPHYDYTTHSRVEEKAEKITGGVSVIILEGIMLFNDRKLLKMMDFKVYMDTPADLCFIRRLMRDQNERGRSVESVINQYLEIVRPMHIKFIEPSKRKADIIIPDGAQNKTVIDIIYNKVRQLLKKNGVKNG GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 24->215|URK_STAHJ|1e-46|49.5|186/207| SEG 3->20|gkgdvfiigivggsgsgk| BL:PDB:NREP 1 BL:PDB:REP 27->213|1ufqB|2e-33|35.9|181/208| RP:PDB:NREP 1 RP:PDB:REP 34->216|1a7jA|2e-24|15.9|182/279| RP:PFM:NREP 1 RP:PFM:REP 21->193|PF00485|3e-30|41.8|170/189|PRK| HM:PFM:NREP 1 HM:PFM:REP 9->200|PF00485|3.3e-43|27.5|189/194|PRK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00485|IPR006083| GO:PFM GO:0008152|"GO:metabolic process"|PF00485|IPR006083| GO:PFM GO:0016301|"GO:kinase activity"|PF00485|IPR006083| RP:SCP:NREP 1 RP:SCP:REP 21->169|1odfA|5e-25|22.1|149/280|c.37.1.6| HM:SCP:REP 8->205|1esmA_|4e-44|29.2|195/311|c.37.1.6|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 860 OP:NHOMOORG 564 OP:PATTERN -------------------------111--1------------------------------------- 111-------------------------------------------------------------------------------------1111-111---111111--111----------1111------------111-----1-1-1----1-11--------11----------------11111----1111111111111111111111111111111111111111111111111111111111111111211211111111111111-111111111111111111111111111111111121111111111111111-11111111111----111111-111----------1------12-11--------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------------1--------------2---------------------------1------------------------------1111--111111111111111111111111-------------1111-111111111111-1111111111111111111111111111111111111111111111111111-111111111111----111111111--1-1111111111111111-----------------------------111111111-11111111111111------------------------11111111-11----1---1--11----1-1--11111-11-1------ --11331-31-1--211111111111---1---111-1111111----11111111111111111221111121111-1111111111-111111111111-1212-24149958832312231472438R3-545122332332133313-243343238724222622223222443a3334387981B61111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 86.9 SQ:SECSTR ########################HHHHHTTTcHHTccEEEEEGGGGccHHHHHHHHHHHTcTTccTGGGccHHHHHHHHHHHHHHcccEEccccccccccTTcccccccccccEEEEEEccTTcccccGGGccEEEEEEEcHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHTGGGGGTccEEEEEEEccccccGGGccccccGGGEE##### PSIPRED ccccccEEEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccEEEEEcccccccccccccEEEccccEEEEEEcHHHcccHHHHHHcccEEEEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHcccHHcccccEEEEcccccEEHHHHHHHHHHHHHHHcccccc //