[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : wbtC
DDBJ      :wbtC         UDP-glucose 4-epimerase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  216/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:263 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   47->164 1lrkA PDBj 9e-10 33.0 %
:RPS:PDB   2->163 1e7rA PDBj 3e-13 13.6 %
:RPS:PDB   189->224 3cwgA PDBj 8e-04 30.6 %
:RPS:SCOP  4->206 1vl0A  c.2.1.2 * 4e-22 23.2 %
:HMM:SCOP  1->225 1gy8A_ c.2.1.2 * 4.4e-29 25.3 %
:RPS:PFM   47->192 PF01370 * Epimerase 1e-11 37.4 %
:HMM:PFM   45->159 PF01370 * Epimerase 1.6e-17 27.8 108/238  
:BLT:SWISS 1->259 GALE_VIBCH 4e-22 34.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31318.1 GT:GENE wbtC GT:PRODUCT UDP-glucose 4-epimerase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1614656..1615447) GB:FROM 1614656 GB:TO 1615447 GB:DIRECTION - GB:GENE wbtC GB:PRODUCT UDP-glucose 4-epimerase GB:PROTEIN_ID ACD31318.1 GB:DB_XREF GI:187713021 GB:GENE:GENE wbtC LENGTH 263 SQ:AASEQ MKKRILVTGLSSYIGNSFAAKYNSDFSIDKISLRDVSWANIDLSGYDAVLHVAGIAHTSKDPKLKEKYYKINTQLTYDLAKQAKDQGVRQFVFLSSIIVYGDSAPIGQQKVITKYTEPKPDDFYGDSKLQTEIKLNSLASDDFNIAIIRPPMVYGEGSKGNYPKLVKFAKYTFIFPNINNQRSVISIDNLSKEIAEIILQTKHGVFLLQDNEYFCTSQFIKNYRKDVLGKRTYLTKIFNPIIRLLAKKVDFINKVFGNLTYEK GT:EXON 1|1-263:0| BL:SWS:NREP 1 BL:SWS:REP 1->259|GALE_VIBCH|4e-22|34.0|256/328| BL:PDB:NREP 1 BL:PDB:REP 47->164|1lrkA|9e-10|33.0|115/338| RP:PDB:NREP 2 RP:PDB:REP 2->163|1e7rA|3e-13|13.6|162/314| RP:PDB:REP 189->224|3cwgA|8e-04|30.6|36/501| RP:PFM:NREP 1 RP:PFM:REP 47->192|PF01370|1e-11|37.4|139/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 45->159|PF01370|1.6e-17|27.8|108/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 4->206|1vl0A|4e-22|23.2|194/281|c.2.1.2| HM:SCP:REP 1->225|1gy8A_|4.4e-29|25.3|225/383|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 234 OP:NHOMOORG 221 OP:PATTERN ----------------1---------------------------------------1----------1 -------1----------------11------1-----11-122-------------1----------1-------------------34---1-----1-1---1----------------------111111--1--11-----1--2------------1---1111-----------------------1----------1--1--1------2-----1----------11111111111111----1---------------------------------1--------------------------1--------11----------------------1------------------------1--1-1----------111-1-1--2-11111111111-11-1111-1---211-111111---1------1-11----------------21----------------------------------1-----111111111111111--1--1-111---------------11---1111111---------11--1-1-11--1--------1-1-1----------1-----1----------------------11--1-11--111--1--------1--1-----1----------111----11--------11--1121-11-------------1------------------1-1------------------1--1------11111-1-1---------------1--------1-11111111--1111-11111111-111-111111111--11-------------------------------------------------------------------------- ------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------1----------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 97.0 SQ:SECSTR ccEEEEEETTTcHHHHHHHHHHTTcTTccTTcHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccTTccccccGGTTcccccGGGHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTHHHHHTccEEEEcccccEEEcEEHHHHHHHHHHHHTccccccEEEccccEEEHHHHHHHHHHHTHTccccEEEEcccTTccccccccTTTHH######## PSIPRED cccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHccccEEEEccccccccHHHccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHccccccccccccccEEHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHccccccc //