[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Francisella tularensis subsp. mediasiatica FSC147 (ftul2)
Gene : wbtE
DDBJ      :wbtE         UDP-glucose/GDP-mannose dehydrogenase
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  680/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1c.26.3
:436 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->433 3g79A PDBj 5e-40 32.0 %
:RPS:PDB   13->407 1dliA PDBj 6e-55 17.1 %
:RPS:SCOP  13->203 1mfzA2  c.2.1.6 * 3e-41 27.9 %
:RPS:SCOP  206->301 1dliA1  a.100.1.4 * 9e-30 19.1 %
:RPS:SCOP  299->405 1dliA3  c.26.3.1 * 3e-13 15.0 %
:HMM:SCOP  11->202 1mv8A2 c.2.1.6 * 2.4e-42 37.2 %
:HMM:SCOP  205->297 1mv8A1 a.100.1.4 * 1e-26 38.7 %
:HMM:SCOP  304->425 1dljA3 c.26.3.1 * 3.5e-27 33.3 %
:RPS:PFM   13->188 PF03721 * UDPG_MGDP_dh_N 2e-28 42.9 %
:RPS:PFM   206->295 PF00984 * UDPG_MGDP_dh 5e-13 44.9 %
:RPS:PFM   322->423 PF03720 * UDPG_MGDP_dh_C 6e-09 32.3 %
:HMM:PFM   13->185 PF03721 * UDPG_MGDP_dh_N 1.5e-48 38.6 171/185  
:HMM:PFM   205->295 PF00984 * UDPG_MGDP_dh 8e-27 34.8 89/96  
:HMM:PFM   322->423 PF03720 * UDPG_MGDP_dh_C 5.3e-23 31.0 100/106  
:BLT:SWISS 14->436 CAPL_STAAU e-133 54.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ACD31316.1 GT:GENE wbtE GT:PRODUCT UDP-glucose/GDP-mannose dehydrogenase GT:DATABASE GIB00719CH01 GT:ORG ftul2 GB:ACCESSION GIB00719CH01 GB:LOCATION complement(1612247..1613557) GB:FROM 1612247 GB:TO 1613557 GB:DIRECTION - GB:GENE wbtE GB:PRODUCT UDP-glucose/GDP-mannose dehydrogenase GB:PROTEIN_ID ACD31316.1 GB:DB_XREF GI:187713019 GB:GENE:GENE wbtE LENGTH 436 SQ:AASEQ MSLYEDIVAKREKVSLVGLGYVGLPIAIAFAKKIDVLGFDICETKVQHYKDGFDPTKEVGDEAVRNTTMKFSCDETSLKECKFHIVAVPTPVKADKTPDLTPIIKASETVGRNLVKGAYVVFESTVYPGVTEDVCVPILEKESGLRSGEDFKVGYSPERINPGDKVHRLETIIKVVSGMDEESLDTIAKVYELVVDAGVYRASSIKVAEAAKVIENSQRDVNIAFVNELSIIFNQMGIDTLEVLAAAATKWNFLNFKPGLVGGHCIGVDPYYLTYKAAELGYHSQVILSGRRINDGMGKFVVENLVKKLISADIPVKRARVAIFGFTFKEDCPDTRNTRVIDMVKELNEYGIEPYIIDPIADKEEAKHEYGLEFDDLSKMVNLDAIIIAVSHEQFKDITKQQFDRLYAHNSRKIIFDIKGSLDKSEFEKDYIYWRL GT:EXON 1|1-436:0| BL:SWS:NREP 1 BL:SWS:REP 14->436|CAPL_STAAU|e-133|54.5|420/424| TM:NTM 1 TM:REGION 15->31| BL:PDB:NREP 1 BL:PDB:REP 1->433|3g79A|5e-40|32.0|419/475| RP:PDB:NREP 1 RP:PDB:REP 13->407|1dliA|6e-55|17.1|380/402| RP:PFM:NREP 3 RP:PFM:REP 13->188|PF03721|2e-28|42.9|175/186|UDPG_MGDP_dh_N| RP:PFM:REP 206->295|PF00984|5e-13|44.9|89/96|UDPG_MGDP_dh| RP:PFM:REP 322->423|PF03720|6e-09|32.3|99/104|UDPG_MGDP_dh_C| HM:PFM:NREP 3 HM:PFM:REP 13->185|PF03721|1.5e-48|38.6|171/185|UDPG_MGDP_dh_N| HM:PFM:REP 205->295|PF00984|8e-27|34.8|89/96|UDPG_MGDP_dh| HM:PFM:REP 322->423|PF03720|5.3e-23|31.0|100/106|UDPG_MGDP_dh_C| GO:PFM:NREP 9 GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF03721|IPR001732| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF03721|IPR001732| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03721|IPR001732| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF00984|IPR014026| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF00984|IPR014026| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00984|IPR014026| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF03720|IPR014027| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF03720|IPR014027| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03720|IPR014027| RP:SCP:NREP 3 RP:SCP:REP 13->203|1mfzA2|3e-41|27.9|190/202|c.2.1.6| RP:SCP:REP 206->301|1dliA1|9e-30|19.1|94/98|a.100.1.4| RP:SCP:REP 299->405|1dliA3|3e-13|15.0|100/108|c.26.3.1| HM:SCP:REP 11->202|1mv8A2|2.4e-42|37.2|191/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 205->297|1mv8A1|1e-26|38.7|93/98|a.100.1.4|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| HM:SCP:REP 304->425|1dljA3|3.5e-27|33.3|108/0|c.26.3.1|1/1|UDP-glucose/GDP-mannose dehydrogenase C-terminal domain| OP:NHOMO 1554 OP:NHOMOORG 837 OP:PATTERN ---1-11-1111-21-11111112222313-21212122322323-4333133-3422112---2-1- 235-41-1223-1-11111-11--13111111111113131121-222111-333131--63221123432-1111----2-11212266431933---32222143323--------------11211112122122222---213113111----1-11111125112311112111121211-1-22-1232334423324232423122233353321543------552111111111111111----------------------1---1--1-----------3311111-121111111111111---------123-1311112111212122211121212-----22412314--1-121--3222222-----3143232211-2211111111111-33243423321-3222222222231111111-12111211111111112211211------------11111111111111-2--34221233333223222----33521111-133512211121231121-1121--142-1231-------221443-223422222322223232232233434224222222---1---2-------12-4131312122321-121232-111111-211-21---2212------22221221222122232-22122222222222212222221243122212122223222122222111321222222222222--1122222----133131112111----1--21111112112524424235342322-323-111111111--222222221-2122223222222222--22111111------------------------------------111221111111- --11--1-------24222-11-1232---------------------23663533-1-2221--------------------------11121111-11--1112-2122----1111---1-21-1-131-11-----1-11-11-1-1-12-11111--1111111161111-21-I211125354131112---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 433 STR:RPRED 99.3 SQ:SECSTR ccHHHHHHccccEEEEEcccHHHHHHHHHHTTTcEEEEEcccHHHHHHHHTTccccccHHHHHHHHHcccEccHHHHHHHccEEEEcccccEETTTTEccHHHHHHHHHHHHHHccccEEEEcccccTTHHHHHHHHHTccccTTTccHHHHEEEccccccTTcTTHHHHccccEEEEccTTccHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTTTcccccccccccccHHHHHHHHHHHHTTTccccEEHHHHHHHHHHHHHHHHHHHHHHHHHTccccccccEEEEEcccccTTccccTTcHHHHHHHHHHTcccEEEEEcTTcccccTTcccEEcccHHHHHHHccEEEcccccGGGGGGGGGEEccccHcccccEEEEccccccHHHHTTTcEE### PSIPRED ccHHHHHHccccEEEEEEccHHHHHHHHHHHccccEEEEEccHHHHHHHHccccccccccHHHHHcccEEEcccHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHccccccccccEEEcccccccccHHHHHHcccEEEEEccHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccccccccHHHHHHHHHHHcccEEEEEcccccHHHHHHcccccccHHHHHccccEEEEEcccHHHHHccHHHHHHHHHHccccEEEEccccccHHHHHHcccEEEc //